Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   AA971_RS00155 Genome accession   NZ_CP011482
Coordinates   31919..32044 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain L7     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 26919..37044
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AA971_RS00130 (AA971_00120) - 26981..29206 (+) 2226 WP_064431757.1 AAA family ATPase -
  AA971_RS00135 (AA971_00125) panD 29196..29549 (+) 354 WP_021307646.1 aspartate 1-decarboxylase -
  AA971_RS00140 (AA971_00130) - 29552..29845 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  AA971_RS00145 (AA971_00135) - 29845..30840 (+) 996 WP_064431758.1 PDZ domain-containing protein -
  AA971_RS00150 (AA971_00140) comB6 30848..31903 (+) 1056 WP_064431759.1 P-type conjugative transfer protein TrbL Machinery gene
  AA971_RS00155 (AA971_00145) comB7 31919..32044 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  AA971_RS00160 (AA971_00150) comB8 32041..32784 (+) 744 WP_064431760.1 type IV secretion system protein Machinery gene
  AA971_RS00165 (AA971_00155) comB9 32784..33761 (+) 978 WP_064431761.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  AA971_RS00170 (AA971_00160) comB10 33754..34884 (+) 1131 WP_064431762.1 DNA type IV secretion system protein ComB10 Machinery gene
  AA971_RS00175 (AA971_00165) - 34954..36366 (+) 1413 WP_064431763.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=146190 AA971_RS00155 WP_001217874.1 31919..32044(+) (comB7) [Helicobacter pylori strain L7]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=146190 AA971_RS00155 WP_001217874.1 31919..32044(+) (comB7) [Helicobacter pylori strain L7]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878


Multiple sequence alignment