Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | AAX05_RS01195 | Genome accession | NZ_CP011377 |
| Coordinates | 260035..260574 (-) | Length | 179 a.a. |
| NCBI ID | WP_080945894.1 | Uniprot ID | - |
| Organism | Moraxella bovoculi strain 23343 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 252575..305007 | 260035..260574 | within | 0 |
Gene organization within MGE regions
Location: 252575..305007
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAX05_RS01155 (AAX05_01155) | glnD | 252575..255325 (+) | 2751 | WP_080945892.1 | [protein-PII] uridylyltransferase | - |
| AAX05_RS01160 (AAX05_01160) | - | 255365..256138 (+) | 774 | WP_080945893.1 | WG repeat-containing protein | - |
| AAX05_RS01165 (AAX05_01165) | - | 256769..257887 (+) | 1119 | WP_046695977.1 | phage integrase central domain-containing protein | - |
| AAX05_RS01170 (AAX05_01170) | - | 257922..258113 (-) | 192 | WP_046695978.1 | hypothetical protein | - |
| AAX05_RS01175 (AAX05_01175) | - | 258124..258507 (-) | 384 | WP_046695979.1 | hypothetical protein | - |
| AAX05_RS01180 (AAX05_01180) | - | 258629..258901 (-) | 273 | WP_046695980.1 | hypothetical protein | - |
| AAX05_RS01185 (AAX05_01185) | - | 258997..259482 (-) | 486 | WP_046695981.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| AAX05_RS01190 (AAX05_01190) | - | 259479..259877 (-) | 399 | WP_046695982.1 | hypothetical protein | - |
| AAX05_RS11420 | - | 259916..260038 (+) | 123 | WP_264673316.1 | hypothetical protein | - |
| AAX05_RS01195 (AAX05_01195) | ssb | 260035..260574 (-) | 540 | WP_080945894.1 | single-stranded DNA-binding protein | Machinery gene |
| AAX05_RS01200 (AAX05_01200) | - | 260577..261179 (-) | 603 | WP_046695983.1 | lambda exonuclease family protein | - |
| AAX05_RS01205 (AAX05_01205) | bet | 261176..261946 (-) | 771 | WP_046695984.1 | phage recombination protein Bet | - |
| AAX05_RS10845 | - | 261943..262089 (-) | 147 | WP_155400091.1 | hypothetical protein | - |
| AAX05_RS01210 (AAX05_01210) | - | 262086..262325 (-) | 240 | WP_046695985.1 | hypothetical protein | - |
| AAX05_RS01215 (AAX05_01215) | - | 262298..262642 (-) | 345 | WP_046695986.1 | hypothetical protein | - |
| AAX05_RS01220 (AAX05_01220) | - | 263616..263786 (-) | 171 | WP_155400048.1 | hypothetical protein | - |
| AAX05_RS01225 (AAX05_01225) | - | 263973..265034 (-) | 1062 | WP_046695988.1 | hypothetical protein | - |
| AAX05_RS10455 | - | 265047..265787 (-) | 741 | WP_080947460.1 | S24 family peptidase | - |
| AAX05_RS11735 (AAX05_01235) | - | 265951..266127 (+) | 177 | WP_227503158.1 | helix-turn-helix transcriptional regulator | - |
| AAX05_RS01240 (AAX05_01240) | - | 266181..266423 (+) | 243 | WP_046695989.1 | helix-turn-helix domain-containing protein | - |
| AAX05_RS01245 (AAX05_01245) | - | 266420..267331 (+) | 912 | WP_046695990.1 | helix-turn-helix domain-containing protein | - |
| AAX05_RS01250 (AAX05_01250) | - | 267324..267968 (+) | 645 | WP_046695991.1 | hypothetical protein | - |
| AAX05_RS01255 (AAX05_01255) | - | 267965..268312 (+) | 348 | WP_155400094.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AAX05_RS01260 (AAX05_01260) | - | 268302..268664 (+) | 363 | WP_046695992.1 | hypothetical protein | - |
| AAX05_RS01265 (AAX05_01265) | - | 268661..268897 (+) | 237 | WP_046695993.1 | hypothetical protein | - |
| AAX05_RS10850 | - | 268894..269064 (+) | 171 | WP_155400095.1 | hypothetical protein | - |
| AAX05_RS01270 (AAX05_01270) | - | 269087..269608 (+) | 522 | WP_046695994.1 | antA/AntB antirepressor family protein | - |
| AAX05_RS01275 (AAX05_01275) | - | 269598..270065 (+) | 468 | WP_080947463.1 | hypothetical protein | - |
| AAX05_RS01285 (AAX05_01285) | - | 270458..271249 (+) | 792 | WP_046695996.1 | hypothetical protein | - |
| AAX05_RS01290 (AAX05_01290) | - | 271406..271909 (+) | 504 | WP_155400096.1 | hypothetical protein | - |
| AAX05_RS01295 (AAX05_01295) | - | 272092..272517 (+) | 426 | WP_046695998.1 | hypothetical protein | - |
| AAX05_RS01300 (AAX05_01300) | - | 272517..273992 (+) | 1476 | WP_046695999.1 | hypothetical protein | - |
| AAX05_RS01305 (AAX05_01305) | - | 273992..275422 (+) | 1431 | WP_046696000.1 | DUF4055 domain-containing protein | - |
| AAX05_RS01310 (AAX05_01310) | - | 275373..276359 (+) | 987 | WP_046696001.1 | minor capsid protein | - |
| AAX05_RS01315 (AAX05_01315) | - | 276408..277073 (+) | 666 | WP_046696002.1 | hypothetical protein | - |
| AAX05_RS01320 (AAX05_01320) | - | 277077..278093 (+) | 1017 | WP_046696003.1 | hypothetical protein | - |
| AAX05_RS01325 (AAX05_01325) | - | 278104..278307 (+) | 204 | WP_046696004.1 | hypothetical protein | - |
| AAX05_RS01330 (AAX05_01330) | - | 278362..278709 (+) | 348 | WP_046696005.1 | hypothetical protein | - |
| AAX05_RS01335 (AAX05_01335) | - | 278711..279085 (+) | 375 | WP_046696006.1 | hypothetical protein | - |
| AAX05_RS01340 (AAX05_01340) | - | 279072..279494 (+) | 423 | WP_227503125.1 | HK97 gp10 family phage protein | - |
| AAX05_RS01345 (AAX05_01345) | - | 279497..279886 (+) | 390 | WP_046696008.1 | phage tail terminator-like protein | - |
| AAX05_RS01350 (AAX05_01350) | - | 279971..280483 (+) | 513 | WP_046696009.1 | Rha family transcriptional regulator | - |
| AAX05_RS01355 (AAX05_01355) | - | 280499..281407 (+) | 909 | WP_046696010.1 | phage tail tube protein | - |
| AAX05_RS01360 (AAX05_01360) | - | 281645..282100 (+) | 456 | WP_046696011.1 | hypothetical protein | - |
| AAX05_RS10460 | - | 282907..283692 (+) | 786 | WP_080945912.1 | hypothetical protein | - |
| AAX05_RS01375 (AAX05_01375) | - | 283985..284503 (+) | 519 | WP_080945913.1 | BRO family protein | - |
| AAX05_RS10855 | - | 284553..284696 (+) | 144 | WP_227503126.1 | hypothetical protein | - |
| AAX05_RS01380 (AAX05_01380) | - | 284862..285353 (+) | 492 | WP_046696013.1 | Panacea domain-containing protein | - |
| AAX05_RS01385 (AAX05_01385) | - | 285340..285696 (+) | 357 | WP_046696014.1 | hypothetical protein | - |
| AAX05_RS01390 (AAX05_01390) | - | 285817..286830 (+) | 1014 | WP_046696015.1 | RelA/SpoT domain-containing protein | - |
| AAX05_RS01395 (AAX05_01395) | - | 286884..290921 (+) | 4038 | WP_046696016.1 | tape measure protein | - |
| AAX05_RS01400 (AAX05_01400) | - | 290923..291177 (+) | 255 | WP_046696017.1 | hypothetical protein | - |
| AAX05_RS01405 (AAX05_01405) | - | 291231..291563 (+) | 333 | WP_046696018.1 | phage tail protein | - |
| AAX05_RS01410 (AAX05_01410) | - | 291640..292014 (+) | 375 | WP_046696019.1 | hypothetical protein | - |
| AAX05_RS01415 (AAX05_01415) | - | 292060..292728 (+) | 669 | WP_046696020.1 | phage minor tail protein L | - |
| AAX05_RS01420 (AAX05_01420) | - | 292725..293516 (+) | 792 | WP_046696021.1 | C40 family peptidase | - |
| AAX05_RS01425 (AAX05_01425) | - | 293513..294106 (+) | 594 | WP_046696022.1 | tail assembly protein | - |
| AAX05_RS10465 | - | 294103..300408 (+) | 6306 | WP_080947465.1 | phage tail protein | - |
| AAX05_RS01435 (AAX05_01435) | - | 300417..300764 (+) | 348 | WP_155400097.1 | hypothetical protein | - |
| AAX05_RS01440 (AAX05_01440) | - | 300761..301816 (+) | 1056 | WP_046696024.1 | hypothetical protein | - |
| AAX05_RS11425 | - | 301883..302017 (+) | 135 | WP_264673317.1 | hypothetical protein | - |
| AAX05_RS01445 (AAX05_01445) | - | 302028..302396 (+) | 369 | WP_046696025.1 | hypothetical protein | - |
| AAX05_RS01450 (AAX05_01450) | - | 302436..303068 (+) | 633 | WP_046696026.1 | N-acetylmuramidase family protein | - |
| AAX05_RS01455 (AAX05_01455) | - | 303332..303952 (+) | 621 | WP_046696027.1 | DedA family protein | - |
| AAX05_RS01465 (AAX05_01465) | - | 304367..304705 (+) | 339 | WP_046696028.1 | hypothetical protein | - |
| AAX05_RS01470 (AAX05_01470) | - | 304702..305007 (+) | 306 | WP_046696029.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 179 a.a. Molecular weight: 19667.86 Da Isoelectric Point: 7.1980
>NTDB_id=145252 AAX05_RS01195 WP_080945894.1 260035..260574(-) (ssb) [Moraxella bovoculi strain 23343]
MASVNKVILVGNLGTDPDVKTFDNGGKIANVSIATSERWTDKNTGEQKEATEWHKVVMHNRLAEIAAEYLAKGSLVYIEG
SLQTRKYTDAQGIERYVTEIRATSMQMLGSRTDGGQGQAPQQGYQQGNGGQWGNQGYQNAPQAQPKRQYPQGMMASPLTA
MQKPPQNTVYQTPNDDTPF
MASVNKVILVGNLGTDPDVKTFDNGGKIANVSIATSERWTDKNTGEQKEATEWHKVVMHNRLAEIAAEYLAKGSLVYIEG
SLQTRKYTDAQGIERYVTEIRATSMQMLGSRTDGGQGQAPQQGYQQGNGGQWGNQGYQNAPQAQPKRQYPQGMMASPLTA
MQKPPQNTVYQTPNDDTPF
Nucleotide
Download Length: 540 bp
>NTDB_id=145252 AAX05_RS01195 WP_080945894.1 260035..260574(-) (ssb) [Moraxella bovoculi strain 23343]
ATGGCAAGTGTAAATAAAGTAATTTTGGTGGGCAACTTAGGTACTGACCCTGATGTCAAAACCTTTGATAACGGTGGCAA
AATAGCCAATGTCTCAATCGCCACCAGCGAACGATGGACGGACAAGAATACAGGTGAGCAGAAAGAAGCGACTGAATGGC
ACAAAGTAGTCATGCACAATCGCCTGGCAGAAATTGCAGCAGAGTACCTAGCCAAAGGTAGCTTAGTCTATATTGAGGGC
AGTTTGCAAACTCGCAAATACACAGATGCTCAGGGCATTGAACGCTATGTAACCGAAATCCGTGCCACCAGTATGCAAAT
GCTTGGCTCTCGCACCGATGGCGGACAAGGGCAAGCGCCACAGCAAGGCTATCAGCAGGGCAATGGTGGGCAATGGGGCA
ATCAAGGATATCAGAACGCACCACAGGCGCAACCAAAACGCCAATACCCACAAGGCATGATGGCAAGCCCATTAACGGCA
ATGCAAAAACCACCCCAAAACACGGTGTATCAGACGCCCAATGATGACACGCCCTTTTAA
ATGGCAAGTGTAAATAAAGTAATTTTGGTGGGCAACTTAGGTACTGACCCTGATGTCAAAACCTTTGATAACGGTGGCAA
AATAGCCAATGTCTCAATCGCCACCAGCGAACGATGGACGGACAAGAATACAGGTGAGCAGAAAGAAGCGACTGAATGGC
ACAAAGTAGTCATGCACAATCGCCTGGCAGAAATTGCAGCAGAGTACCTAGCCAAAGGTAGCTTAGTCTATATTGAGGGC
AGTTTGCAAACTCGCAAATACACAGATGCTCAGGGCATTGAACGCTATGTAACCGAAATCCGTGCCACCAGTATGCAAAT
GCTTGGCTCTCGCACCGATGGCGGACAAGGGCAAGCGCCACAGCAAGGCTATCAGCAGGGCAATGGTGGGCAATGGGGCA
ATCAAGGATATCAGAACGCACCACAGGCGCAACCAAAACGCCAATACCCACAAGGCATGATGGCAAGCCCATTAACGGCA
ATGCAAAAACCACCCCAAAACACGGTGTATCAGACGCCCAATGATGACACGCCCTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
50 |
100 |
0.531 |
| ssb | Glaesserella parasuis strain SC1401 |
47.15 |
100 |
0.508 |
| ssb | Neisseria meningitidis MC58 |
42.222 |
100 |
0.425 |
| ssb | Neisseria gonorrhoeae MS11 |
42.222 |
100 |
0.425 |