Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   AAV29_RS12545 Genome accession   NZ_CP011346
Coordinates   2605155..2605469 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain JJ-D34     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2600155..2610469
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAV29_RS12500 (AAV29_12500) sinI 2600838..2601011 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  AAV29_RS12505 (AAV29_12505) sinR 2601045..2601380 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AAV29_RS12510 (AAV29_12510) tasA 2601428..2602213 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  AAV29_RS12515 (AAV29_12515) sipW 2602277..2602861 (-) 585 WP_046559873.1 signal peptidase I SipW -
  AAV29_RS12520 (AAV29_12520) tapA 2602833..2603504 (-) 672 WP_046559874.1 amyloid fiber anchoring/assembly protein TapA -
  AAV29_RS12525 (AAV29_12525) - 2603763..2604092 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  AAV29_RS12530 (AAV29_12530) - 2604132..2604311 (-) 180 WP_003153093.1 YqzE family protein -
  AAV29_RS12535 (AAV29_12535) comGG 2604368..2604745 (-) 378 WP_046559875.1 competence type IV pilus minor pilin ComGG Machinery gene
  AAV29_RS12540 (AAV29_12540) comGF 2604746..2605141 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  AAV29_RS12545 (AAV29_12545) comGE 2605155..2605469 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  AAV29_RS12550 (AAV29_12550) comGD 2605453..2605890 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  AAV29_RS12555 (AAV29_12555) comGC 2605880..2606146 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  AAV29_RS12560 (AAV29_12560) comGB 2606193..2607230 (-) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  AAV29_RS12565 (AAV29_12565) comGA 2607217..2608287 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  AAV29_RS12570 (AAV29_12570) - 2608479..2609429 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=144863 AAV29_RS12545 WP_015388003.1 2605155..2605469(-) (comGE) [Bacillus velezensis strain JJ-D34]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=144863 AAV29_RS12545 WP_015388003.1 2605155..2605469(-) (comGE) [Bacillus velezensis strain JJ-D34]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGACGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481


Multiple sequence alignment