Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AAV29_RS12500 | Genome accession | NZ_CP011346 |
| Coordinates | 2600838..2601011 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain JJ-D34 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2595838..2606011
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAV29_RS12485 (AAV29_12485) | gcvT | 2596656..2597756 (-) | 1101 | WP_014305405.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AAV29_RS12490 (AAV29_12490) | - | 2598179..2599849 (+) | 1671 | WP_046559872.1 | DEAD/DEAH box helicase | - |
| AAV29_RS12495 (AAV29_12495) | - | 2599867..2600661 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| AAV29_RS12500 (AAV29_12500) | sinI | 2600838..2601011 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| AAV29_RS12505 (AAV29_12505) | sinR | 2601045..2601380 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AAV29_RS12510 (AAV29_12510) | tasA | 2601428..2602213 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| AAV29_RS12515 (AAV29_12515) | sipW | 2602277..2602861 (-) | 585 | WP_046559873.1 | signal peptidase I SipW | - |
| AAV29_RS12520 (AAV29_12520) | tapA | 2602833..2603504 (-) | 672 | WP_046559874.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AAV29_RS12525 (AAV29_12525) | - | 2603763..2604092 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| AAV29_RS12530 (AAV29_12530) | - | 2604132..2604311 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| AAV29_RS12535 (AAV29_12535) | comGG | 2604368..2604745 (-) | 378 | WP_046559875.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AAV29_RS12540 (AAV29_12540) | comGF | 2604746..2605141 (-) | 396 | WP_046559876.1 | competence type IV pilus minor pilin ComGF | - |
| AAV29_RS12545 (AAV29_12545) | comGE | 2605155..2605469 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| AAV29_RS12550 (AAV29_12550) | comGD | 2605453..2605890 (-) | 438 | WP_044053464.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=144860 AAV29_RS12500 WP_003153105.1 2600838..2601011(+) (sinI) [Bacillus velezensis strain JJ-D34]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=144860 AAV29_RS12500 WP_003153105.1 2600838..2601011(+) (sinI) [Bacillus velezensis strain JJ-D34]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |