Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | FCFHV36_RS10645 | Genome accession | NZ_CP011147 |
| Coordinates | 2104879..2105349 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934759.1 | Uniprot ID | A0A2I7Y8V1 |
| Organism | Staphylococcus aureus strain FCFHV36 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2075899..2126392 | 2104879..2105349 | within | 0 |
Gene organization within MGE regions
Location: 2075899..2126392
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FCFHV36_RS10440 (FCFHV36_1897) | scn | 2075899..2076249 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| FCFHV36_RS10445 (FCFHV36_1898) | - | 2076934..2077383 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| FCFHV36_RS16300 (FCFHV36_1899) | - | 2077478..2077816 (-) | 339 | Protein_1993 | SH3 domain-containing protein | - |
| FCFHV36_RS10455 (FCFHV36_1900) | sak | 2078463..2078954 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| FCFHV36_RS10460 (FCFHV36_1901) | - | 2079145..2079900 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| FCFHV36_RS10465 (FCFHV36_1902) | - | 2079912..2080166 (-) | 255 | WP_000611512.1 | phage holin | - |
| FCFHV36_RS15640 | - | 2080218..2080325 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| FCFHV36_RS15645 | pepG1 | 2080378..2080512 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| FCFHV36_RS10480 (FCFHV36_1903) | - | 2080704..2081000 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| FCFHV36_RS10485 (FCFHV36_1904) | - | 2081058..2081345 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| FCFHV36_RS15650 (FCFHV36_1905) | - | 2081392..2081544 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| FCFHV36_RS10495 (FCFHV36_1906) | - | 2081534..2085319 (-) | 3786 | WP_000582154.1 | phage tail spike protein | - |
| FCFHV36_RS10500 (FCFHV36_1907) | - | 2085335..2086819 (-) | 1485 | WP_000567396.1 | phage distal tail protein | - |
| FCFHV36_RS10505 (FCFHV36_1908) | - | 2086816..2091348 (-) | 4533 | WP_001557459.1 | phage tail tape measure protein | - |
| FCFHV36_RS16555 (FCFHV36_1909) | gpGT | 2091405..2091542 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| FCFHV36_RS10515 (FCFHV36_1910) | gpG | 2091593..2091943 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| FCFHV36_RS15655 | - | 2091993..2092223 (-) | 231 | Protein_2007 | Ig-like domain-containing protein | - |
| FCFHV36_RS10520 (FCFHV36_1911) | - | 2092259..2092903 (-) | 645 | WP_000985142.1 | major tail protein | - |
| FCFHV36_RS10525 (FCFHV36_1912) | - | 2092904..2093311 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| FCFHV36_RS10530 (FCFHV36_1913) | - | 2093308..2093712 (-) | 405 | WP_000114341.1 | HK97 gp10 family phage protein | - |
| FCFHV36_RS10535 (FCFHV36_1914) | - | 2093709..2094071 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| FCFHV36_RS10540 (FCFHV36_1915) | - | 2094055..2094339 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| FCFHV36_RS10545 (FCFHV36_1916) | - | 2094329..2094613 (-) | 285 | WP_000238241.1 | hypothetical protein | - |
| FCFHV36_RS10550 (FCFHV36_1917) | - | 2094633..2095778 (-) | 1146 | WP_000154568.1 | phage major capsid protein | - |
| FCFHV36_RS10555 (FCFHV36_1918) | - | 2095801..2096538 (-) | 738 | WP_000861911.1 | head maturation protease, ClpP-related | - |
| FCFHV36_RS10560 (FCFHV36_1919) | - | 2096522..2097685 (-) | 1164 | WP_000025268.1 | phage portal protein | - |
| FCFHV36_RS10565 (FCFHV36_1920) | - | 2097701..2099362 (-) | 1662 | WP_000625096.1 | terminase large subunit | - |
| FCFHV36_RS10570 (FCFHV36_1921) | - | 2099359..2099703 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| FCFHV36_RS10575 (FCFHV36_1922) | - | 2099833..2100132 (-) | 300 | WP_000988332.1 | HNH endonuclease | - |
| FCFHV36_RS10580 (FCFHV36_1923) | - | 2100364..2100780 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| FCFHV36_RS10585 (FCFHV36_1924) | - | 2100808..2101008 (-) | 201 | WP_001557462.1 | DUF1514 family protein | - |
| FCFHV36_RS10590 (FCFHV36_1925) | rinB | 2101008..2101157 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| FCFHV36_RS10595 (FCFHV36_1926) | - | 2101154..2101360 (-) | 207 | WP_000195784.1 | DUF1381 domain-containing protein | - |
| FCFHV36_RS10600 (FCFHV36_1927) | - | 2101357..2101602 (-) | 246 | WP_001282077.1 | hypothetical protein | - |
| FCFHV36_RS10605 (FCFHV36_1928) | - | 2101639..2102175 (-) | 537 | WP_000185693.1 | dUTPase | - |
| FCFHV36_RS10610 (FCFHV36_1929) | - | 2102172..2102417 (-) | 246 | WP_001065108.1 | DUF1024 family protein | - |
| FCFHV36_RS10615 (FCFHV36_1930) | - | 2102432..2102674 (-) | 243 | WP_000221877.1 | SAV1978 family virulence-associated passenger protein | - |
| FCFHV36_RS10620 (FCFHV36_1931) | - | 2102677..2102934 (-) | 258 | WP_000111491.1 | DUF3310 domain-containing protein | - |
| FCFHV36_RS10625 (FCFHV36_1932) | - | 2102934..2103305 (-) | 372 | WP_000101279.1 | SA1788 family PVL leukocidin-associated protein | - |
| FCFHV36_RS10630 (FCFHV36_1933) | - | 2103318..2103722 (-) | 405 | WP_000401969.1 | RusA family crossover junction endodeoxyribonuclease | - |
| FCFHV36_RS10635 (FCFHV36_1934) | - | 2103731..2103949 (-) | 219 | WP_000338528.1 | hypothetical protein | - |
| FCFHV36_RS10640 (FCFHV36_1935) | - | 2103956..2104849 (-) | 894 | WP_000148333.1 | DnaD domain protein | - |
| FCFHV36_RS10645 (FCFHV36_1936) | ssbA | 2104879..2105349 (-) | 471 | WP_000934759.1 | single-stranded DNA-binding protein | Machinery gene |
| FCFHV36_RS10650 (FCFHV36_1937) | - | 2105350..2105967 (-) | 618 | WP_078065756.1 | MBL fold metallo-hydrolase | - |
| FCFHV36_RS10655 (FCFHV36_1938) | - | 2106048..2106968 (-) | 921 | WP_000180600.1 | recombinase RecT | - |
| FCFHV36_RS10660 (FCFHV36_1939) | - | 2106970..2108913 (-) | 1944 | WP_000700554.1 | AAA family ATPase | - |
| FCFHV36_RS10665 (FCFHV36_1940) | - | 2108922..2109185 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| FCFHV36_RS10670 (FCFHV36_1941) | - | 2109194..2109454 (-) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| FCFHV36_RS10675 (FCFHV36_1942) | - | 2109459..2109761 (-) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| FCFHV36_RS15660 (FCFHV36_1943) | - | 2109856..2110017 (-) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| FCFHV36_RS10685 (FCFHV36_1944) | - | 2110014..2110337 (-) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| FCFHV36_RS10690 (FCFHV36_1945) | - | 2110392..2110772 (+) | 381 | WP_000762521.1 | DUF2513 domain-containing protein | - |
| FCFHV36_RS10695 (FCFHV36_1946) | - | 2110759..2110956 (-) | 198 | WP_001148862.1 | hypothetical protein | - |
| FCFHV36_RS10700 (FCFHV36_1947) | - | 2110972..2111721 (-) | 750 | WP_001148338.1 | phage antirepressor KilAC domain-containing protein | - |
| FCFHV36_RS10705 (FCFHV36_1948) | - | 2111778..2111987 (+) | 210 | WP_000772137.1 | hypothetical protein | - |
| FCFHV36_RS15665 (FCFHV36_1949) | - | 2111980..2112120 (-) | 141 | WP_000939495.1 | hypothetical protein | - |
| FCFHV36_RS10715 (FCFHV36_1950) | - | 2112135..2112578 (-) | 444 | WP_000435360.1 | hypothetical protein | - |
| FCFHV36_RS10720 (FCFHV36_1951) | - | 2112591..2112833 (-) | 243 | WP_000639923.1 | DUF739 family protein | - |
| FCFHV36_RS10725 (FCFHV36_1952) | - | 2112997..2113713 (+) | 717 | WP_001083975.1 | LexA family transcriptional regulator | - |
| FCFHV36_RS10730 (FCFHV36_1953) | - | 2113725..2114579 (+) | 855 | WP_001557601.1 | HIRAN domain-containing protein | - |
| FCFHV36_RS16405 (FCFHV36_1954) | - | 2114653..2114799 (+) | 147 | WP_000345949.1 | hypothetical protein | - |
| FCFHV36_RS10735 (FCFHV36_1955) | - | 2114796..2114981 (+) | 186 | WP_000109189.1 | hypothetical protein | - |
| FCFHV36_RS10740 (FCFHV36_1956) | - | 2115052..2115234 (+) | 183 | WP_000705245.1 | hypothetical protein | - |
| FCFHV36_RS10745 (FCFHV36_1957) | - | 2115313..2116026 (+) | 714 | WP_001549185.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| FCFHV36_RS10750 (FCFHV36_1958) | - | 2116217..2117254 (+) | 1038 | WP_000857200.1 | tyrosine-type recombinase/integrase | - |
| FCFHV36_RS10755 (FCFHV36_1959) | sph | 2117311..2118135 (+) | 825 | Protein_2056 | sphingomyelin phosphodiesterase | - |
| FCFHV36_RS10760 (FCFHV36_1960) | lukG | 2118373..2119389 (-) | 1017 | WP_000595392.1 | bi-component leukocidin LukGH subunit G | - |
| FCFHV36_RS10765 (FCFHV36_1961) | lukH | 2119411..2120466 (-) | 1056 | WP_000791411.1 | bi-component leukocidin LukGH subunit H | - |
| FCFHV36_RS10770 (FCFHV36_1962) | - | 2120902..2122125 (+) | 1224 | WP_000206625.1 | ArgE/DapE family deacylase | - |
| FCFHV36_RS10775 (FCFHV36_1963) | - | 2122569..2123876 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| FCFHV36_RS10780 (FCFHV36_1964) | groL | 2124416..2126032 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| FCFHV36_RS10785 (FCFHV36_1965) | groES | 2126108..2126392 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=142798 FCFHV36_RS10645 WP_000934759.1 2104879..2105349(-) (ssbA) [Staphylococcus aureus strain FCFHV36]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=142798 FCFHV36_RS10645 WP_000934759.1 2104879..2105349(-) (ssbA) [Staphylococcus aureus strain FCFHV36]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |