Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | F384_RS09860 | Genome accession | NZ_CP011132 |
| Coordinates | 2161333..2161731 (-) | Length | 132 a.a. |
| NCBI ID | WP_046481313.1 | Uniprot ID | - |
| Organism | Citrobacter amalonaticus Y19 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2116326..2194641 | 2161333..2161731 | within | 0 |
Gene organization within MGE regions
Location: 2116326..2194641
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F384_RS09615 (F384_09620) | - | 2116503..2117765 (+) | 1263 | WP_046481272.1 | tyrosine-type recombinase/integrase | - |
| F384_RS09620 (F384_09625) | - | 2118264..2119307 (+) | 1044 | WP_046481273.1 | nucleotidyltransferase | - |
| F384_RS09625 (F384_09630) | - | 2119304..2121040 (+) | 1737 | WP_046481274.1 | ThiF family adenylyltransferase | - |
| F384_RS28710 | - | 2121033..2121503 (+) | 471 | WP_075212272.1 | Mov34/MPN/PAD-1 family protein | - |
| F384_RS09630 (F384_09635) | - | 2121531..2123123 (+) | 1593 | WP_046481275.1 | SAVED domain-containing protein | - |
| F384_RS09635 (F384_09640) | mobH | 2123246..2125060 (-) | 1815 | WP_065366073.1 | MobH family relaxase | - |
| F384_RS09640 (F384_09645) | - | 2125073..2125285 (-) | 213 | WP_046481276.1 | toxin-antitoxin system HicB family antitoxin | - |
| F384_RS09645 (F384_09650) | - | 2125343..2125972 (-) | 630 | WP_046481277.1 | ParA family protein | - |
| F384_RS09650 (F384_09655) | - | 2126290..2126772 (-) | 483 | WP_046481278.1 | JAB domain-containing protein | - |
| F384_RS09655 (F384_09660) | - | 2127044..2127385 (+) | 342 | WP_046481279.1 | DUF3742 family protein | - |
| F384_RS09660 (F384_09665) | - | 2127390..2128886 (-) | 1497 | WP_046481280.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| F384_RS09665 (F384_09670) | - | 2128883..2129200 (-) | 318 | WP_046481281.1 | hypothetical protein | - |
| F384_RS09670 (F384_09675) | - | 2129203..2130561 (-) | 1359 | WP_077259946.1 | integrating conjugative element protein | - |
| F384_RS09675 (F384_09680) | - | 2130595..2131524 (-) | 930 | WP_046481282.1 | TIGR03756 family integrating conjugative element protein | - |
| F384_RS09680 (F384_09685) | - | 2131521..2131934 (-) | 414 | WP_046481283.1 | TIGR03757 family integrating conjugative element protein | - |
| F384_RS09685 (F384_09690) | - | 2131963..2132196 (+) | 234 | WP_148675904.1 | hypothetical protein | - |
| F384_RS27920 | - | 2132543..2133094 (+) | 552 | WP_049106081.1 | hypothetical protein | - |
| F384_RS09695 (F384_09700) | - | 2133203..2133391 (-) | 189 | WP_046481285.1 | hypothetical protein | - |
| F384_RS09700 (F384_09705) | - | 2133657..2134814 (-) | 1158 | WP_046481286.1 | hypothetical protein | - |
| F384_RS09705 (F384_09710) | - | 2134804..2135730 (-) | 927 | WP_046481287.1 | hypothetical protein | - |
| F384_RS09710 (F384_09715) | - | 2135925..2138627 (-) | 2703 | WP_046481288.1 | conjugative transfer ATPase | - |
| F384_RS09715 (F384_09720) | - | 2138627..2139028 (-) | 402 | WP_046481289.1 | TIGR03751 family conjugal transfer lipoprotein | - |
| F384_RS09720 (F384_09725) | - | 2139028..2140449 (-) | 1422 | WP_046481290.1 | TIGR03752 family integrating conjugative element protein | - |
| F384_RS09725 (F384_09730) | - | 2140449..2141279 (-) | 831 | WP_046481291.1 | TIGR03749 family integrating conjugative element protein | - |
| F384_RS09730 (F384_09735) | - | 2141276..2141917 (-) | 642 | WP_046481292.1 | PFL_4703 family integrating conjugative element protein | - |
| F384_RS09735 (F384_09740) | - | 2141914..2142273 (-) | 360 | WP_046481293.1 | TIGR03750 family conjugal transfer protein | - |
| F384_RS09740 (F384_09745) | - | 2142273..2142611 (-) | 339 | WP_046481294.1 | TIGR03745 family integrating conjugative element membrane protein | - |
| F384_RS09745 (F384_09750) | - | 2142639..2142857 (-) | 219 | WP_226991637.1 | TIGR03758 family integrating conjugative element protein | - |
| F384_RS09750 (F384_09755) | - | 2142869..2143180 (-) | 312 | WP_226991638.1 | RAQPRD family integrative conjugative element protein | - |
| F384_RS09755 (F384_09760) | - | 2143324..2144025 (-) | 702 | WP_046481296.1 | TIGR03747 family integrating conjugative element membrane protein | - |
| F384_RS09760 (F384_09765) | traD | 2144018..2146129 (-) | 2112 | WP_046481297.1 | type IV conjugative transfer system coupling protein TraD | - |
| F384_RS09765 (F384_09770) | - | 2146126..2146614 (-) | 489 | WP_046481298.1 | integrating conjugative element protein | - |
| F384_RS09770 (F384_09775) | - | 2146641..2147171 (-) | 531 | WP_046481299.1 | transglycosylase SLT domain-containing protein | - |
| F384_RS09775 (F384_09780) | - | 2147147..2147830 (-) | 684 | WP_077259939.1 | TIGR03759 family integrating conjugative element protein | - |
| F384_RS28715 | - | 2147841..2148329 (-) | 489 | WP_075212271.1 | hypothetical protein | - |
| F384_RS09785 (F384_09790) | - | 2148463..2148747 (-) | 285 | WP_046481300.1 | hypothetical protein | - |
| F384_RS09790 (F384_09795) | - | 2149081..2150094 (+) | 1014 | WP_046481301.1 | DUF4917 family protein | - |
| F384_RS09795 (F384_09800) | - | 2150387..2152189 (-) | 1803 | WP_046481302.1 | DNA topoisomerase III | - |
| F384_RS09800 (F384_09805) | - | 2152349..2152522 (-) | 174 | WP_155403988.1 | hypothetical protein | - |
| F384_RS09805 (F384_09810) | - | 2152685..2154919 (-) | 2235 | WP_306463071.1 | DEAD/DEAH box helicase | - |
| F384_RS09810 (F384_09815) | - | 2155005..2155268 (-) | 264 | WP_148675902.1 | hypothetical protein | - |
| F384_RS09815 (F384_09820) | - | 2155357..2155659 (-) | 303 | WP_049106072.1 | hypothetical protein | - |
| F384_RS09820 (F384_09825) | - | 2155675..2155941 (-) | 267 | WP_046481306.1 | hypothetical protein | - |
| F384_RS09825 (F384_09830) | - | 2155986..2157089 (-) | 1104 | WP_046481307.1 | DUF6094 domain-containing protein | - |
| F384_RS09830 (F384_09835) | - | 2157160..2157774 (-) | 615 | WP_046481308.1 | hypothetical protein | - |
| F384_RS09835 (F384_09840) | - | 2157846..2158544 (-) | 699 | WP_162200240.1 | DUF3275 family protein | - |
| F384_RS09840 (F384_09845) | - | 2158572..2158985 (-) | 414 | WP_046481310.1 | DUF3577 domain-containing protein | - |
| F384_RS09845 (F384_09850) | - | 2159351..2159719 (-) | 369 | WP_049106069.1 | DUF3085 domain-containing protein | - |
| F384_RS09850 (F384_09855) | - | 2159741..2159962 (-) | 222 | WP_046481311.1 | hypothetical protein | - |
| F384_RS09855 (F384_09860) | - | 2160180..2161187 (-) | 1008 | WP_046481312.1 | phosphoadenosine phosphosulfate reductase family protein | - |
| F384_RS09860 (F384_09865) | ssb | 2161333..2161731 (-) | 399 | WP_046481313.1 | single-stranded DNA-binding protein | Machinery gene |
| F384_RS09865 (F384_09870) | - | 2161752..2162243 (-) | 492 | WP_049106066.1 | DUF3158 family protein | - |
| F384_RS09870 (F384_09875) | - | 2162224..2163042 (-) | 819 | WP_046481314.1 | PFL_4669 family integrating conjugative element protein | - |
| F384_RS09875 (F384_09880) | - | 2163335..2163547 (-) | 213 | WP_046498025.1 | TraR/DksA family transcriptional regulator | - |
| F384_RS09880 (F384_09885) | - | 2163537..2164121 (-) | 585 | WP_077259937.1 | DUF2857 domain-containing protein | - |
| F384_RS09885 (F384_09890) | - | 2164118..2165587 (-) | 1470 | WP_052746915.1 | ParB family protein | - |
| F384_RS09890 (F384_09895) | - | 2165628..2165813 (-) | 186 | WP_046481316.1 | AlpA family transcriptional regulator | - |
| F384_RS09895 (F384_09900) | - | 2165923..2166819 (-) | 897 | WP_046481317.1 | hypothetical protein | - |
| F384_RS09900 (F384_09905) | - | 2167414..2168997 (+) | 1584 | WP_046481318.1 | GMC family oxidoreductase | - |
| F384_RS09905 (F384_09910) | - | 2169015..2170448 (+) | 1434 | WP_046498027.1 | aldehyde dehydrogenase family protein | - |
| F384_RS09910 (F384_09915) | - | 2170524..2171936 (+) | 1413 | WP_046481319.1 | sugar porter family MFS transporter | - |
| F384_RS09915 (F384_09920) | - | 2171988..2172767 (-) | 780 | WP_226991639.1 | YdcF family protein | - |
| F384_RS09920 (F384_09925) | tkt | 2172835..2174841 (-) | 2007 | WP_046498029.1 | transketolase | - |
| F384_RS09925 (F384_09930) | tal | 2174860..2175810 (-) | 951 | WP_046481321.1 | transaldolase | - |
| F384_RS09930 (F384_09935) | deoC | 2175875..2176618 (-) | 744 | WP_046481322.1 | deoxyribose-phosphate aldolase | - |
| F384_RS09935 (F384_09940) | - | 2176830..2177648 (-) | 819 | WP_046481323.1 | GntR family transcriptional regulator | - |
| F384_RS09940 (F384_09945) | adhP | 2177770..2178779 (-) | 1010 | Protein_1987 | alcohol dehydrogenase AdhP | - |
| F384_RS09950 (F384_09955) | - | 2178861..2181290 (-) | 2430 | WP_046498031.1 | glycyl radical protein | - |
| F384_RS09955 (F384_09960) | - | 2181310..2182140 (-) | 831 | WP_046498033.1 | glycyl-radical enzyme activating protein | - |
| F384_RS09960 (F384_09965) | - | 2182171..2183070 (-) | 900 | WP_200056031.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| F384_RS09965 (F384_09970) | - | 2183073..2183912 (-) | 840 | WP_046481326.1 | PTS sugar transporter subunit IIC | - |
| F384_RS09970 (F384_09975) | - | 2183937..2184431 (-) | 495 | WP_046481327.1 | PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB | - |
| F384_RS09975 (F384_09980) | - | 2184445..2184891 (-) | 447 | WP_046481328.1 | PTS sugar transporter subunit IIA | - |
| F384_RS09980 (F384_09985) | yidA | 2185250..2186083 (-) | 834 | WP_046481329.1 | sugar-phosphatase | - |
| F384_RS09985 (F384_09990) | - | 2186231..2187790 (+) | 1560 | WP_046481330.1 | acyl CoA:acetate/3-ketoacid CoA transferase | - |
| F384_RS09990 (F384_09995) | - | 2187792..2188547 (+) | 756 | WP_046481331.1 | enoyl-CoA hydratase/isomerase family protein | - |
| F384_RS09995 (F384_10000) | - | 2188624..2189901 (+) | 1278 | WP_046481332.1 | MFS transporter | - |
| F384_RS10000 (F384_10005) | - | 2190273..2191334 (-) | 1062 | WP_046481333.1 | glycoside hydrolase family 88 protein | - |
| F384_RS10005 (F384_10010) | - | 2191522..2192286 (+) | 765 | WP_046481334.1 | GntR family transcriptional regulator | - |
| F384_RS27925 | - | 2192279..2193136 (+) | 858 | WP_049106042.1 | HAD-IIB family hydrolase | - |
| F384_RS28720 | - | 2193312..2193533 (-) | 222 | WP_052746916.1 | helix-turn-helix domain-containing protein | - |
| F384_RS10015 (F384_10020) | - | 2193530..2193991 (-) | 462 | WP_046481335.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 132 a.a. Molecular weight: 14679.60 Da Isoelectric Point: 6.7224
>NTDB_id=142646 F384_RS09860 WP_046481313.1 2161333..2161731(-) (ssb) [Citrobacter amalonaticus Y19]
MAQRGLNKVCLIGYLGQDPEVRYTADKQPVAVFSVATGDSWKDKETGETKERTQWHRIVVYNKLAEIAAAHLKKGTQVYL
EGRLQVRKWLDSIGAERQSTEIVVDINGMLQMLGKPEPDKAPGDHSSDNAGE
MAQRGLNKVCLIGYLGQDPEVRYTADKQPVAVFSVATGDSWKDKETGETKERTQWHRIVVYNKLAEIAAAHLKKGTQVYL
EGRLQVRKWLDSIGAERQSTEIVVDINGMLQMLGKPEPDKAPGDHSSDNAGE
Nucleotide
Download Length: 399 bp
>NTDB_id=142646 F384_RS09860 WP_046481313.1 2161333..2161731(-) (ssb) [Citrobacter amalonaticus Y19]
ATGGCCCAGAGAGGACTGAATAAAGTTTGCCTGATTGGATATTTAGGGCAAGACCCGGAAGTTCGTTATACTGCGGATAA
ACAACCTGTGGCAGTATTTTCCGTGGCGACGGGCGATTCATGGAAAGATAAAGAGACCGGGGAAACGAAAGAACGGACGC
AGTGGCACCGGATTGTAGTGTATAACAAACTTGCGGAAATAGCTGCCGCACATCTTAAGAAGGGCACCCAGGTGTATCTT
GAGGGACGATTACAGGTCAGGAAATGGCTGGACAGTATCGGTGCAGAACGCCAGTCCACTGAAATCGTGGTCGATATCAA
CGGGATGTTACAGATGCTGGGTAAACCTGAACCGGATAAAGCGCCGGGTGATCATTCATCGGATAATGCGGGCGAGTAA
ATGGCCCAGAGAGGACTGAATAAAGTTTGCCTGATTGGATATTTAGGGCAAGACCCGGAAGTTCGTTATACTGCGGATAA
ACAACCTGTGGCAGTATTTTCCGTGGCGACGGGCGATTCATGGAAAGATAAAGAGACCGGGGAAACGAAAGAACGGACGC
AGTGGCACCGGATTGTAGTGTATAACAAACTTGCGGAAATAGCTGCCGCACATCTTAAGAAGGGCACCCAGGTGTATCTT
GAGGGACGATTACAGGTCAGGAAATGGCTGGACAGTATCGGTGCAGAACGCCAGTCCACTGAAATCGTGGTCGATATCAA
CGGGATGTTACAGATGCTGGGTAAACCTGAACCGGATAAAGCGCCGGGTGATCATTCATCGGATAATGCGGGCGAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
59.13 |
87.121 |
0.515 |
| ssb | Neisseria meningitidis MC58 |
53.211 |
82.576 |
0.439 |
| ssb | Neisseria gonorrhoeae MS11 |
53.211 |
82.576 |
0.439 |
| ssb | Glaesserella parasuis strain SC1401 |
50.459 |
82.576 |
0.417 |