Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | PhaeoP73_RS07850 | Genome accession | NZ_CP010636 |
| Coordinates | 1611381..1611851 (+) | Length | 156 a.a. |
| NCBI ID | WP_024097670.1 | Uniprot ID | - |
| Organism | Phaeobacter gallaeciensis strain P73 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1601454..1639693 | 1611381..1611851 | within | 0 |
Gene organization within MGE regions
Location: 1601454..1639693
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PhaeoP73_RS22410 (PhaeoP73_01560) | - | 1601454..1601693 (-) | 240 | WP_024097695.1 | DUF551 domain-containing protein | - |
| PhaeoP73_RS07735 (PhaeoP73_01561) | - | 1601693..1602010 (-) | 318 | WP_024097694.1 | hypothetical protein | - |
| PhaeoP73_RS21990 (PhaeoP73_01562) | - | 1602003..1602584 (-) | 582 | WP_024097693.1 | hypothetical protein | - |
| PhaeoP73_RS07745 (PhaeoP73_01563) | - | 1602606..1602983 (-) | 378 | WP_024097692.1 | DUF1364 domain-containing protein | - |
| PhaeoP73_RS07750 (PhaeoP73_01564) | - | 1602980..1603435 (-) | 456 | WP_024097691.1 | hypothetical protein | - |
| PhaeoP73_RS07755 (PhaeoP73_01565) | - | 1603449..1603739 (-) | 291 | WP_024097690.1 | hypothetical protein | - |
| PhaeoP73_RS07760 (PhaeoP73_01566) | - | 1603739..1603927 (-) | 189 | WP_024097689.1 | hypothetical protein | - |
| PhaeoP73_RS07765 (PhaeoP73_01567) | - | 1603927..1604631 (-) | 705 | WP_024097688.1 | 3'-5' exonuclease | - |
| PhaeoP73_RS07770 (PhaeoP73_01568) | - | 1604621..1605289 (-) | 669 | WP_024097687.1 | ERF family protein | - |
| PhaeoP73_RS07775 (PhaeoP73_01569) | - | 1605386..1605715 (-) | 330 | WP_024097686.1 | hypothetical protein | - |
| PhaeoP73_RS07780 (PhaeoP73_01570) | - | 1605712..1606008 (-) | 297 | WP_024097685.1 | hypothetical protein | - |
| PhaeoP73_RS07785 (PhaeoP73_01571) | - | 1606014..1606358 (-) | 345 | WP_024097684.1 | hypothetical protein | - |
| PhaeoP73_RS07790 (PhaeoP73_01572) | - | 1606564..1606848 (-) | 285 | WP_024097683.1 | hypothetical protein | - |
| PhaeoP73_RS07795 (PhaeoP73_01573) | - | 1606841..1607101 (-) | 261 | WP_024097682.1 | hypothetical protein | - |
| PhaeoP73_RS07800 (PhaeoP73_01574) | - | 1607098..1607733 (-) | 636 | WP_024097681.1 | XRE family transcriptional regulator | - |
| PhaeoP73_RS07805 | - | 1607811..1608026 (+) | 216 | WP_102892808.1 | hypothetical protein | - |
| PhaeoP73_RS07810 (PhaeoP73_01576) | - | 1608060..1608383 (+) | 324 | WP_145957930.1 | hypothetical protein | - |
| PhaeoP73_RS07815 (PhaeoP73_01578) | - | 1608502..1608684 (+) | 183 | WP_024097677.1 | hypothetical protein | - |
| PhaeoP73_RS07820 (PhaeoP73_01579) | - | 1608727..1609029 (+) | 303 | WP_024097676.1 | hypothetical protein | - |
| PhaeoP73_RS07825 (PhaeoP73_01580) | - | 1609029..1609337 (+) | 309 | WP_024097675.1 | VRR-NUC domain protein | - |
| PhaeoP73_RS07830 (PhaeoP73_01581) | - | 1609334..1609867 (+) | 534 | WP_024097674.1 | GIY-YIG nuclease family protein | - |
| PhaeoP73_RS07835 (PhaeoP73_01582) | - | 1609951..1610661 (+) | 711 | WP_043939784.1 | hypothetical protein | - |
| PhaeoP73_RS07840 (PhaeoP73_01583) | - | 1610648..1611016 (+) | 369 | WP_024097672.1 | hypothetical protein | - |
| PhaeoP73_RS07845 (PhaeoP73_01584) | - | 1611013..1611381 (+) | 369 | WP_024097671.1 | helix-turn-helix domain-containing protein | - |
| PhaeoP73_RS07850 (PhaeoP73_01585) | ssb | 1611381..1611851 (+) | 471 | WP_024097670.1 | single-stranded DNA-binding protein | Machinery gene |
| PhaeoP73_RS07855 (PhaeoP73_01586) | - | 1611851..1612273 (+) | 423 | WP_040104068.1 | HNH endonuclease signature motif containing protein | - |
| PhaeoP73_RS07860 (PhaeoP73_01587) | - | 1612285..1612671 (+) | 387 | WP_040104067.1 | hypothetical protein | - |
| PhaeoP73_RS07865 (PhaeoP73_01589) | nusG | 1612940..1613530 (+) | 591 | WP_024097666.1 | transcription termination/antitermination protein NusG | - |
| PhaeoP73_RS07870 (PhaeoP73_01590) | - | 1614158..1614460 (+) | 303 | WP_024097665.1 | hypothetical protein | - |
| PhaeoP73_RS07875 (PhaeoP73_01591) | - | 1614441..1615778 (+) | 1338 | WP_024097664.1 | phage terminase large subunit | - |
| PhaeoP73_RS07880 (PhaeoP73_01592) | - | 1615775..1617766 (+) | 1992 | WP_024097663.1 | portal protein | - |
| PhaeoP73_RS07885 (PhaeoP73_01593) | - | 1617780..1618622 (+) | 843 | WP_024097662.1 | hypothetical protein | - |
| PhaeoP73_RS07890 (PhaeoP73_01594) | - | 1618635..1619876 (+) | 1242 | WP_024097661.1 | P22 phage major capsid protein family protein | - |
| PhaeoP73_RS21995 (PhaeoP73_01595) | - | 1619933..1620076 (+) | 144 | WP_024097660.1 | hypothetical protein | - |
| PhaeoP73_RS07900 (PhaeoP73_01596) | - | 1620073..1620471 (+) | 399 | WP_145957931.1 | hypothetical protein | - |
| PhaeoP73_RS07905 (PhaeoP73_01597) | - | 1620476..1621912 (+) | 1437 | WP_024097658.1 | hypothetical protein | - |
| PhaeoP73_RS22000 (PhaeoP73_01598) | - | 1621909..1622061 (+) | 153 | WP_024097657.1 | hypothetical protein | - |
| PhaeoP73_RS07910 (PhaeoP73_01599) | - | 1622058..1622486 (+) | 429 | WP_024097656.1 | hypothetical protein | - |
| PhaeoP73_RS07915 (PhaeoP73_01600) | - | 1622486..1623370 (+) | 885 | WP_024097655.1 | hypothetical protein | - |
| PhaeoP73_RS07920 (PhaeoP73_01601) | - | 1623374..1623967 (+) | 594 | WP_024097654.1 | phage tail tip lysozyme | - |
| PhaeoP73_RS07925 (PhaeoP73_01602) | - | 1623977..1625236 (+) | 1260 | WP_024097653.1 | hypothetical protein | - |
| PhaeoP73_RS07930 (PhaeoP73_01603) | - | 1625239..1626759 (+) | 1521 | WP_024097652.1 | hypothetical protein | - |
| PhaeoP73_RS07935 | - | 1626731..1626913 (-) | 183 | WP_040104064.1 | hypothetical protein | - |
| PhaeoP73_RS07940 (PhaeoP73_01604) | - | 1626914..1627096 (-) | 183 | WP_024097651.1 | hypothetical protein | - |
| PhaeoP73_RS07945 (PhaeoP73_01605) | - | 1627129..1627422 (-) | 294 | WP_024097650.1 | Arc family DNA-binding protein | - |
| PhaeoP73_RS22415 | - | 1627526..1627744 (+) | 219 | WP_040104063.1 | Arc family DNA-binding protein | - |
| PhaeoP73_RS07955 (PhaeoP73_01606) | - | 1627774..1628547 (+) | 774 | WP_024097649.1 | KilA-N domain-containing protein | - |
| PhaeoP73_RS07960 (PhaeoP73_01607) | - | 1628544..1629062 (+) | 519 | WP_024097648.1 | hypothetical protein | - |
| PhaeoP73_RS07965 (PhaeoP73_01608) | - | 1629059..1629421 (+) | 363 | WP_024097647.1 | hypothetical protein | - |
| PhaeoP73_RS07970 (PhaeoP73_01609) | - | 1629508..1630344 (+) | 837 | WP_024097646.1 | hypothetical protein | - |
| PhaeoP73_RS07975 (PhaeoP73_01610) | - | 1630355..1632943 (+) | 2589 | WP_096705124.1 | hypothetical protein | - |
| PhaeoP73_RS07980 (PhaeoP73_01612) | - | 1633353..1633556 (+) | 204 | WP_024097642.1 | hypothetical protein | - |
| PhaeoP73_RS22005 (PhaeoP73_01613) | - | 1633553..1633723 (+) | 171 | WP_024097641.1 | hypothetical protein | - |
| PhaeoP73_RS07985 (PhaeoP73_01614) | - | 1633716..1634132 (+) | 417 | WP_024097640.1 | hypothetical protein | - |
| PhaeoP73_RS07990 (PhaeoP73_01615) | - | 1634192..1634710 (+) | 519 | WP_024097639.1 | N-acetylmuramoyl-L-alanine amidase | - |
| PhaeoP73_RS07995 (PhaeoP73_01616) | - | 1634707..1634895 (+) | 189 | WP_024097638.1 | hypothetical protein | - |
| PhaeoP73_RS08000 (PhaeoP73_01617) | - | 1634892..1635131 (+) | 240 | WP_024097637.1 | hypothetical protein | - |
| PhaeoP73_RS22330 | - | 1635309..1635440 (-) | 132 | WP_275541792.1 | hypothetical protein | - |
| PhaeoP73_RS08005 (PhaeoP73_01619) | - | 1635602..1635886 (-) | 285 | WP_024097635.1 | hypothetical protein | - |
| PhaeoP73_RS08015 (PhaeoP73_01621) | - | 1636001..1636234 (-) | 234 | WP_024097634.1 | hypothetical protein | - |
| PhaeoP73_RS08020 (PhaeoP73_01622) | - | 1636248..1636457 (-) | 210 | WP_024097633.1 | hypothetical protein | - |
| PhaeoP73_RS08025 (PhaeoP73_01623) | - | 1636496..1637131 (-) | 636 | WP_024097632.1 | hypothetical protein | - |
| PhaeoP73_RS08030 (PhaeoP73_01624) | - | 1637165..1637953 (-) | 789 | WP_420874947.1 | DNA cytosine methyltransferase | - |
| PhaeoP73_RS08035 (PhaeoP73_01625) | - | 1638018..1638245 (+) | 228 | WP_024097630.1 | hypothetical protein | - |
| PhaeoP73_RS08040 (PhaeoP73_01627) | - | 1638491..1639693 (-) | 1203 | WP_024097628.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 16734.28 Da Isoelectric Point: 5.7697
>NTDB_id=139519 PhaeoP73_RS07850 WP_024097670.1 1611381..1611851(+) (ssb) [Phaeobacter gallaeciensis strain P73]
MAGSLNKVQLIGNLGRDPEVRSFQNGGKVCNLRLATSETWKDRNTGERREKTEWHSVSIFSEGLVRVAEQYLRKGSKVYI
EGQLQTRKWQDQSGQDRYSTEVVLQGIGGTLTMLDSAQGGSSSGGGGDSGGCGDQGSGYGSQGGSSHNIDDTEIPF
MAGSLNKVQLIGNLGRDPEVRSFQNGGKVCNLRLATSETWKDRNTGERREKTEWHSVSIFSEGLVRVAEQYLRKGSKVYI
EGQLQTRKWQDQSGQDRYSTEVVLQGIGGTLTMLDSAQGGSSSGGGGDSGGCGDQGSGYGSQGGSSHNIDDTEIPF
Nucleotide
Download Length: 471 bp
>NTDB_id=139519 PhaeoP73_RS07850 WP_024097670.1 1611381..1611851(+) (ssb) [Phaeobacter gallaeciensis strain P73]
ATGGCAGGCAGTTTGAACAAGGTCCAGTTGATCGGAAATTTGGGCCGTGACCCCGAAGTCCGCAGCTTCCAGAACGGCGG
CAAGGTCTGCAACCTGCGTTTGGCAACTTCTGAGACGTGGAAAGACCGCAACACGGGCGAACGCCGCGAAAAGACGGAGT
GGCATTCTGTCTCGATCTTCTCCGAGGGCTTGGTTCGCGTGGCAGAGCAATACCTTCGCAAAGGCTCCAAGGTCTACATC
GAAGGCCAGTTGCAGACCCGAAAATGGCAGGACCAGAGCGGCCAGGACCGGTACTCAACTGAGGTCGTATTGCAGGGCAT
CGGCGGGACGCTGACCATGCTGGACAGCGCTCAGGGCGGCAGTAGCTCCGGCGGTGGCGGGGATAGCGGCGGCTGCGGGG
ATCAGGGGTCCGGCTACGGGAGCCAGGGCGGGTCTTCGCACAACATTGATGATACGGAGATACCTTTCTAA
ATGGCAGGCAGTTTGAACAAGGTCCAGTTGATCGGAAATTTGGGCCGTGACCCCGAAGTCCGCAGCTTCCAGAACGGCGG
CAAGGTCTGCAACCTGCGTTTGGCAACTTCTGAGACGTGGAAAGACCGCAACACGGGCGAACGCCGCGAAAAGACGGAGT
GGCATTCTGTCTCGATCTTCTCCGAGGGCTTGGTTCGCGTGGCAGAGCAATACCTTCGCAAAGGCTCCAAGGTCTACATC
GAAGGCCAGTTGCAGACCCGAAAATGGCAGGACCAGAGCGGCCAGGACCGGTACTCAACTGAGGTCGTATTGCAGGGCAT
CGGCGGGACGCTGACCATGCTGGACAGCGCTCAGGGCGGCAGTAGCTCCGGCGGTGGCGGGGATAGCGGCGGCTGCGGGG
ATCAGGGGTCCGGCTACGGGAGCCAGGGCGGGTCTTCGCACAACATTGATGATACGGAGATACCTTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
64.516 |
79.487 |
0.513 |
| ssb | Glaesserella parasuis strain SC1401 |
53.378 |
94.872 |
0.506 |
| ssb | Neisseria gonorrhoeae MS11 |
45.985 |
87.821 |
0.404 |
| ssb | Neisseria meningitidis MC58 |
45.985 |
87.821 |
0.404 |