Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | RT44_RS10335 | Genome accession | NZ_CP010402 |
| Coordinates | 2047661..2048131 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934769.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain GR2 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2018166..2069859 | 2047661..2048131 | within | 0 |
Gene organization within MGE regions
Location: 2018166..2069859
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RT44_RS10120 (RT44_10115) | scn | 2018166..2018516 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| RT44_RS10125 (RT44_10120) | - | 2019027..2019362 (-) | 336 | Protein_1920 | SH3 domain-containing protein | - |
| RT44_RS10130 (RT44_10130) | sak | 2020013..2020504 (-) | 492 | WP_000920038.1 | staphylokinase | - |
| RT44_RS10135 (RT44_10135) | - | 2020695..2021450 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| RT44_RS10140 (RT44_10140) | - | 2021462..2021716 (-) | 255 | WP_000611512.1 | phage holin | - |
| RT44_RS10145 (RT44_10145) | - | 2021768..2021875 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| RT44_RS14775 (RT44_10150) | pepG1 | 2021928..2022062 (-) | 135 | WP_000880502.1 | type I toxin-antitoxin system toxin PepG1 | - |
| RT44_RS10150 (RT44_10155) | - | 2022247..2022621 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| RT44_RS10155 (RT44_10160) | - | 2022677..2022964 (-) | 288 | WP_001262620.1 | hypothetical protein | - |
| RT44_RS10160 (RT44_10165) | - | 2023010..2023162 (-) | 153 | WP_001000058.1 | hypothetical protein | - |
| RT44_RS15115 | - | 2023155..2026937 (-) | 3783 | Protein_1929 | phage tail spike protein | - |
| RT44_RS10175 (RT44_10180) | - | 2026953..2028443 (-) | 1491 | WP_001154317.1 | phage tail domain-containing protein | - |
| RT44_RS10180 (RT44_10185) | - | 2028443..2033125 (-) | 4683 | WP_001133535.1 | phage tail tape measure protein | - |
| RT44_RS10185 (RT44_10190) | - | 2033181..2033303 (-) | 123 | WP_000571956.1 | hypothetical protein | - |
| RT44_RS10190 (RT44_10195) | - | 2033363..2033809 (-) | 447 | WP_000442601.1 | hypothetical protein | - |
| RT44_RS10195 (RT44_10200) | - | 2033874..2034827 (-) | 954 | WP_000570652.1 | major tail protein | - |
| RT44_RS10200 (RT44_10205) | - | 2034828..2035208 (-) | 381 | WP_000611449.1 | hypothetical protein | - |
| RT44_RS10205 (RT44_10210) | - | 2035205..2035582 (-) | 378 | WP_000501244.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| RT44_RS10210 (RT44_10215) | - | 2035582..2035917 (-) | 336 | WP_000975314.1 | head-tail adaptor protein | - |
| RT44_RS10215 (RT44_10220) | - | 2035904..2036236 (-) | 333 | WP_001177489.1 | head-tail connector protein | - |
| RT44_RS10220 (RT44_10225) | - | 2036245..2036403 (-) | 159 | WP_001252099.1 | hypothetical protein | - |
| RT44_RS10225 (RT44_10230) | - | 2036439..2037686 (-) | 1248 | WP_000849958.1 | phage major capsid protein | - |
| RT44_RS10230 (RT44_10235) | - | 2037774..2038358 (-) | 585 | WP_000032523.1 | HK97 family phage prohead protease | - |
| RT44_RS10235 (RT44_10240) | - | 2038351..2039601 (-) | 1251 | WP_000511062.1 | phage portal protein | - |
| RT44_RS10240 (RT44_10245) | - | 2039607..2039807 (-) | 201 | WP_000365301.1 | hypothetical protein | - |
| RT44_RS10245 (RT44_10250) | - | 2039821..2041515 (-) | 1695 | WP_000133309.1 | phage terminase family protein | - |
| RT44_RS10250 (RT44_10255) | - | 2041515..2041985 (-) | 471 | WP_000919028.1 | phage terminase small subunit P27 family | - |
| RT44_RS10255 (RT44_10260) | - | 2042114..2042458 (-) | 345 | WP_016169209.1 | HNH endonuclease | - |
| RT44_RS10260 (RT44_10265) | - | 2042474..2042926 (-) | 453 | WP_000406193.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| RT44_RS10265 (RT44_10270) | - | 2043040..2043501 (-) | 462 | WP_000282752.1 | hypothetical protein | - |
| RT44_RS10275 (RT44_10280) | - | 2043524..2043724 (-) | 201 | WP_001813913.1 | DUF1514 family protein | - |
| RT44_RS10280 (RT44_10285) | - | 2043724..2043873 (-) | 150 | WP_001813911.1 | transcriptional activator RinB | - |
| RT44_RS10285 (RT44_10290) | - | 2043876..2044076 (-) | 201 | WP_001125015.1 | hypothetical protein | - |
| RT44_RS10290 (RT44_10295) | - | 2044051..2044239 (-) | 189 | WP_000195782.1 | DUF1381 domain-containing protein | - |
| RT44_RS10295 (RT44_10300) | - | 2044236..2044481 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| RT44_RS10300 (RT44_10305) | - | 2044518..2045054 (-) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| RT44_RS15220 | - | 2045047..2045217 (-) | 171 | WP_000714403.1 | hypothetical protein | - |
| RT44_RS10305 (RT44_10310) | - | 2045204..2045458 (-) | 255 | Protein_1956 | DUF1024 family protein | - |
| RT44_RS10310 (RT44_10315) | - | 2045473..2045715 (-) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| RT44_RS10315 (RT44_10320) | - | 2045719..2046087 (-) | 369 | WP_000101273.1 | SA1788 family PVL leukocidin-associated protein | - |
| RT44_RS10320 (RT44_10325) | - | 2046100..2046504 (-) | 405 | WP_000401964.1 | RusA family crossover junction endodeoxyribonuclease | - |
| RT44_RS10325 (RT44_10330) | - | 2046513..2046731 (-) | 219 | WP_000338528.1 | hypothetical protein | - |
| RT44_RS10330 (RT44_10335) | - | 2046738..2047631 (-) | 894 | WP_054170581.1 | DnaD domain-containing protein | - |
| RT44_RS10335 (RT44_10340) | ssbA | 2047661..2048131 (-) | 471 | WP_000934769.1 | single-stranded DNA-binding protein | Machinery gene |
| RT44_RS10340 (RT44_10345) | - | 2048132..2048749 (-) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| RT44_RS10345 (RT44_10350) | - | 2048830..2049750 (-) | 921 | WP_054170582.1 | recombinase RecT | - |
| RT44_RS10350 (RT44_10355) | - | 2049752..2051707 (-) | 1956 | WP_001813910.1 | AAA family ATPase | - |
| RT44_RS10355 (RT44_10360) | - | 2051704..2051967 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| RT44_RS10360 (RT44_10365) | - | 2051976..2052236 (-) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| RT44_RS10365 (RT44_10370) | - | 2052329..2052490 (-) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| RT44_RS10370 (RT44_10375) | - | 2052487..2052807 (-) | 321 | WP_001120935.1 | DUF771 domain-containing protein | - |
| RT44_RS10375 (RT44_10380) | - | 2052866..2053093 (+) | 228 | WP_000801108.1 | hypothetical protein | - |
| RT44_RS10380 (RT44_10385) | - | 2053095..2053286 (-) | 192 | WP_000389906.1 | hypothetical protein | - |
| RT44_RS10385 (RT44_10390) | - | 2053336..2053692 (+) | 357 | WP_000768245.1 | DUF2513 domain-containing protein | - |
| RT44_RS10390 (RT44_10395) | - | 2053687..2053881 (-) | 195 | WP_001148859.1 | hypothetical protein | - |
| RT44_RS10395 (RT44_10400) | - | 2053897..2054685 (-) | 789 | WP_001148565.1 | phage antirepressor KilAC domain-containing protein | - |
| RT44_RS10400 (RT44_10405) | - | 2054701..2054943 (-) | 243 | WP_000639922.1 | DUF739 family protein | - |
| RT44_RS10405 (RT44_10410) | - | 2055107..2055823 (+) | 717 | WP_001083967.1 | LexA family transcriptional regulator | - |
| RT44_RS10410 (RT44_10415) | - | 2055835..2056692 (+) | 858 | WP_000804508.1 | HIRAN domain-containing protein | - |
| RT44_RS10415 (RT44_10420) | - | 2056737..2056919 (+) | 183 | WP_000705243.1 | hypothetical protein | - |
| RT44_RS10420 (RT44_10425) | - | 2056955..2057101 (+) | 147 | WP_001013104.1 | hypothetical protein | - |
| RT44_RS10425 (RT44_10430) | - | 2057098..2057712 (-) | 615 | WP_000191459.1 | hypothetical protein | - |
| RT44_RS10430 (RT44_10435) | - | 2057820..2058857 (+) | 1038 | WP_000857176.1 | site-specific integrase | - |
| RT44_RS10435 (RT44_10440) | sph | 2058908..2059738 (+) | 831 | Protein_1982 | sphingomyelin phosphodiesterase | - |
| RT44_RS10440 (RT44_10445) | lukG | 2060239..2061255 (-) | 1017 | WP_000595401.1 | bi-component leukocidin LukGH subunit G | - |
| RT44_RS10445 (RT44_10450) | lukH | 2061277..2062329 (-) | 1053 | WP_000791406.1 | bi-component leukocidin LukGH subunit H | - |
| RT44_RS10450 (RT44_10455) | - | 2062765..2063988 (+) | 1224 | WP_000206636.1 | ArgE/DapE family deacylase | - |
| RT44_RS10455 (RT44_10460) | - | 2064711..2065154 (-) | 444 | WP_000361985.1 | hypothetical protein | - |
| RT44_RS10460 (RT44_10465) | - | 2066042..2067349 (+) | 1308 | WP_001045075.1 | TrkH family potassium uptake protein | - |
| RT44_RS10465 (RT44_10470) | groL | 2067883..2069499 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| RT44_RS10470 (RT44_10475) | groES | 2069575..2069859 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17671.55 Da Isoelectric Point: 5.2672
>NTDB_id=136845 RT44_RS10335 WP_000934769.1 2047661..2048131(-) (ssbA) [Staphylococcus aureus strain GR2]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=136845 RT44_RS10335 WP_000934769.1 2047661..2048131(-) (ssbA) [Staphylococcus aureus strain GR2]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |