Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   RU84_RS02725 Genome accession   NZ_CP010397
Coordinates   557290..557643 (-) Length   117 a.a.
NCBI ID   WP_001214081.1    Uniprot ID   -
Organism   Acinetobacter baumannii strain 6200     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 555670..587793 557290..557643 within 0


Gene organization within MGE regions


Location: 555670..587793
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RU84_RS02710 (RU84_02710) - 555670..556737 (+) 1068 WP_000107856.1 tyrosine-type recombinase/integrase -
  RU84_RS02715 (RU84_02715) - 556765..557061 (-) 297 WP_000218943.1 hypothetical protein -
  RU84_RS02720 (RU84_02720) - 557061..557279 (-) 219 WP_039244313.1 hypothetical protein -
  RU84_RS02725 (RU84_02725) ssb 557290..557643 (-) 354 WP_001214081.1 single-stranded DNA-binding protein Machinery gene
  RU84_RS02730 (RU84_02730) - 557631..557948 (-) 318 WP_039244315.1 hypothetical protein -
  RU84_RS02735 (RU84_02735) - 557952..558470 (-) 519 WP_039244318.1 hypothetical protein -
  RU84_RS02740 (RU84_02740) - 558473..558904 (-) 432 WP_039244320.1 DUF2528 family protein -
  RU84_RS02745 (RU84_02745) - 558972..559172 (-) 201 WP_039244321.1 hypothetical protein -
  RU84_RS02750 (RU84_02750) - 559191..559526 (-) 336 WP_039244322.1 hypothetical protein -
  RU84_RS02755 (RU84_02755) - 559523..562261 (-) 2739 WP_039244324.1 toprim domain-containing protein -
  RU84_RS02760 (RU84_02760) - 562355..562546 (-) 192 WP_032040900.1 hypothetical protein -
  RU84_RS02765 (RU84_02765) - 562639..562980 (+) 342 WP_000786717.1 helix-turn-helix domain-containing protein -
  RU84_RS02770 (RU84_02770) - 563025..563240 (-) 216 WP_005136258.1 hypothetical protein -
  RU84_RS02775 (RU84_02775) - 563341..563586 (-) 246 WP_039244331.1 hypothetical protein -
  RU84_RS02780 (RU84_02780) - 563589..563783 (-) 195 WP_039244333.1 hypothetical protein -
  RU84_RS19915 - 564221..564850 (+) 630 WP_052247505.1 hypothetical protein -
  RU84_RS02790 (RU84_02790) - 565167..565367 (-) 201 WP_000130086.1 TraR/DksA C4-type zinc finger protein -
  RU84_RS02795 (RU84_02795) - 565364..565603 (-) 240 WP_000113727.1 ogr/Delta-like zinc finger family protein -
  RU84_RS02800 (RU84_02800) - 565731..567044 (-) 1314 WP_039244336.1 contractile injection system protein, VgrG/Pvc8 family -
  RU84_RS02805 (RU84_02805) - 567045..567485 (-) 441 WP_039244338.1 phage tail protein -
  RU84_RS02810 (RU84_02810) - 567491..569941 (-) 2451 WP_039244341.1 phage tail tape measure protein -
  RU84_RS19470 - 569955..570068 (-) 114 WP_079393773.1 GpE family phage tail protein -
  RU84_RS02815 (RU84_02815) - 570095..570436 (-) 342 WP_039244344.1 phage tail assembly protein -
  RU84_RS02820 (RU84_02820) - 570503..571021 (-) 519 WP_039244347.1 phage major tail tube protein -
  RU84_RS02825 (RU84_02825) - 571034..572209 (-) 1176 WP_039244349.1 phage tail sheath protein -
  RU84_RS02830 (RU84_02830) - 572404..573573 (+) 1170 WP_079393767.1 acyltransferase -
  RU84_RS20290 - 573566..576517 (-) 2952 WP_052247506.1 phage tail protein -
  RU84_RS02840 (RU84_02840) - 576529..577134 (-) 606 WP_039244352.1 phage tail protein I -
  RU84_RS02845 (RU84_02845) - 577134..578036 (-) 903 WP_039244353.1 baseplate J/gp47 family protein -
  RU84_RS02850 (RU84_02850) - 578033..578380 (-) 348 WP_039244356.1 GPW/gp25 family protein -
  RU84_RS02855 (RU84_02855) - 578377..579003 (-) 627 WP_039244357.1 phage baseplate assembly protein V -
  RU84_RS02860 (RU84_02860) - 579076..579525 (-) 450 WP_039244359.1 phage virion morphogenesis protein -
  RU84_RS02865 (RU84_02865) - 579522..580049 (-) 528 WP_005137979.1 phage tail protein -
  RU84_RS02870 (RU84_02870) - 580046..580876 (-) 831 WP_039244364.1 N-acetylmuramidase family protein -
  RU84_RS02875 (RU84_02875) - 580873..581142 (-) 270 WP_024436838.1 phage holin family protein -
  RU84_RS02880 (RU84_02880) - 581139..581489 (-) 351 WP_001114936.1 putative holin -
  RU84_RS02885 (RU84_02885) - 581498..581707 (-) 210 WP_000666002.1 tail protein X -
  RU84_RS02890 (RU84_02890) - 581708..582160 (-) 453 WP_039244369.1 head completion/stabilization protein -
  RU84_RS02895 (RU84_02895) gpM 582263..583027 (-) 765 WP_039244371.1 phage terminase small subunit -
  RU84_RS02900 (RU84_02900) - 583038..584027 (-) 990 WP_039244373.1 phage major capsid protein, P2 family -
  RU84_RS02905 (RU84_02905) - 584042..584845 (-) 804 WP_032014584.1 GPO family capsid scaffolding protein -
  RU84_RS02910 (RU84_02910) - 585001..586785 (+) 1785 WP_039244375.1 terminase large subunit domain-containing protein -
  RU84_RS02915 (RU84_02915) - 586786..587793 (+) 1008 WP_032014579.1 phage portal protein -

Sequence

Protein


Download         Length: 117 a.a.        Molecular weight: 13319.05 Da        Isoelectric Point: 9.7939

>NTDB_id=136771 RU84_RS02725 WP_001214081.1 557290..557643(-) (ssb) [Acinetobacter baumannii strain 6200]
MRGINKVILVGVLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQDRYVTEVRAITFQSLDSLPQANPV

Nucleotide


Download         Length: 354 bp        

>NTDB_id=136771 RU84_RS02725 WP_001214081.1 557290..557643(-) (ssb) [Acinetobacter baumannii strain 6200]
ATGCGCGGAATAAACAAAGTGATATTGGTCGGTGTGCTGGGTGCCAATCCAATTCCTAAACAGTTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGAACTGGTGACTGGATTGAAAATACAGAGTGGC
ATCGTATTGTTGCCCACAACAGACTAGGAGAAATTGCCTGCCAATTTCTTAAAAAAGGTTCAAAAGTTTATATCGAAGGG
TCATTACATACACGGAAATGGACTGACCAAAACAATCAAGACCGTTACGTAACTGAAGTTAGAGCCATTACTTTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-106)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

56.364

94.017

0.53
  ssb Vibrio cholerae strain A1552

55.556

84.615

0.47
  ssb Neisseria gonorrhoeae MS11

41.905

89.744

0.376
  ssb Neisseria meningitidis MC58

41.905

89.744

0.376

Multiple sequence alignment