Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   RP72_RS13365 Genome accession   NZ_CP010314
Coordinates   2536744..2537175 (-) Length   143 a.a.
NCBI ID   WP_004398628.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain 3NA isolate 1970 (Michel and Millet)     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2531744..2542175
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RP72_RS13315 (RP72_13315) sinI 2531938..2532111 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  RP72_RS13320 (RP72_13320) sinR 2532145..2532480 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  RP72_RS13325 (RP72_13325) tasA 2532573..2533358 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  RP72_RS13330 (RP72_13330) sipW 2533422..2533994 (-) 573 WP_003246088.1 signal peptidase I SipW -
  RP72_RS13335 (RP72_13335) tapA 2533978..2534739 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  RP72_RS13340 (RP72_13340) yqzG 2535011..2535337 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  RP72_RS13345 (RP72_13345) spoIITA 2535379..2535558 (-) 180 WP_003230176.1 YqzE family protein -
  RP72_RS13350 (RP72_13350) comGG 2535629..2536003 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  RP72_RS13355 (RP72_13355) comGF 2536004..2536387 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  RP72_RS13360 (RP72_13360) comGE 2536413..2536760 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  RP72_RS13365 (RP72_13365) comGD 2536744..2537175 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  RP72_RS13370 (RP72_13370) comGC 2537165..2537461 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  RP72_RS13375 (RP72_13375) comGB 2537475..2538512 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  RP72_RS13380 (RP72_13380) comGA 2538499..2539569 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  RP72_RS13390 (RP72_13390) corA 2539981..2540934 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 143 a.a.        Molecular weight: 16008.62 Da        Isoelectric Point: 10.0432

>NTDB_id=136281 RP72_RS13365 WP_004398628.1 2536744..2537175(-) (comGD) [Bacillus subtilis subsp. subtilis strain 3NA isolate 1970 (Michel and Millet)]
MNIKLNEEKGFTLLESLLVLSLASILLVAVFTTLPPAYDNTAVRQAASQLKNDIMLTQQTAISRQQRTKILFHKKEYQLV
IGDTVIERPYATGLSIELLTLKDRLEFNEKGHPNAGGKIRVKGHAVYDITVYLGSGRVNVERK

Nucleotide


Download         Length: 432 bp        

>NTDB_id=136281 RP72_RS13365 WP_004398628.1 2536744..2537175(-) (comGD) [Bacillus subtilis subsp. subtilis strain 3NA isolate 1970 (Michel and Millet)]
TTGAACATTAAATTAAACGAGGAGAAGGGGTTTACCCTTTTAGAAAGTTTGCTTGTGTTAAGCCTTGCCTCTATCCTCCT
GGTGGCCGTCTTCACTACACTTCCTCCTGCTTATGACAATACAGCTGTCCGACAGGCAGCAAGTCAGCTGAAAAATGATA
TTATGCTCACACAGCAGACTGCTATTTCCCGTCAACAAAGAACAAAAATTCTCTTTCATAAAAAAGAATATCAATTAGTC
ATTGGTGATACGGTTATTGAACGTCCGTATGCAACGGGACTTTCTATAGAACTGCTGACATTAAAAGACCGTTTGGAATT
TAATGAGAAAGGGCACCCGAATGCAGGCGGAAAAATACGAGTAAAAGGCCATGCCGTTTATGACATAACAGTTTATCTAG
GGAGCGGGAGAGTCAATGTGGAGAGAAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment