Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | RP72_RS13315 | Genome accession | NZ_CP010314 |
| Coordinates | 2531938..2532111 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain 3NA isolate 1970 (Michel and Millet) | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2526938..2537111
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RP72_RS13300 (RP72_13300) | gcvT | 2527737..2528825 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| RP72_RS13305 (RP72_13305) | hepAA | 2529267..2530940 (+) | 1674 | WP_004398544.1 | SNF2-related protein | - |
| RP72_RS13310 (RP72_13310) | yqhG | 2530961..2531755 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| RP72_RS13315 (RP72_13315) | sinI | 2531938..2532111 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| RP72_RS13320 (RP72_13320) | sinR | 2532145..2532480 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| RP72_RS13325 (RP72_13325) | tasA | 2532573..2533358 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| RP72_RS13330 (RP72_13330) | sipW | 2533422..2533994 (-) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| RP72_RS13335 (RP72_13335) | tapA | 2533978..2534739 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| RP72_RS13340 (RP72_13340) | yqzG | 2535011..2535337 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| RP72_RS13345 (RP72_13345) | spoIITA | 2535379..2535558 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| RP72_RS13350 (RP72_13350) | comGG | 2535629..2536003 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| RP72_RS13355 (RP72_13355) | comGF | 2536004..2536387 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| RP72_RS13360 (RP72_13360) | comGE | 2536413..2536760 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=136276 RP72_RS13315 WP_003230187.1 2531938..2532111(+) (sinI) [Bacillus subtilis subsp. subtilis strain 3NA isolate 1970 (Michel and Millet)]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=136276 RP72_RS13315 WP_003230187.1 2531938..2532111(+) (sinI) [Bacillus subtilis subsp. subtilis strain 3NA isolate 1970 (Michel and Millet)]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |