Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   NCDO2118_RS11605 Genome accession   NZ_CP009054
Coordinates   2367171..2367455 (-) Length   94 a.a.
NCBI ID   WP_012898619.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis NCDO 2118     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2362171..2372455
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NCDO2118_RS11575 (NCDO2118_2219) - 2362612..2362989 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  NCDO2118_RS11580 (NCDO2118_2220) - 2363194..2364060 (+) 867 WP_012898615.1 RluA family pseudouridine synthase -
  NCDO2118_RS11585 (NCDO2118_2221) - 2364098..2364907 (-) 810 WP_012898616.1 metal ABC transporter permease -
  NCDO2118_RS11590 (NCDO2118_2222) - 2364900..2365637 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  NCDO2118_RS11595 (NCDO2118_2223) - 2365814..2366656 (-) 843 WP_012898618.1 metal ABC transporter substrate-binding protein -
  NCDO2118_RS11600 (NCDO2118_2224) - 2366653..2367090 (-) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  NCDO2118_RS11605 (NCDO2118_2225) comGG 2367171..2367455 (-) 285 WP_012898619.1 competence type IV pilus minor pilin ComGG Machinery gene
  NCDO2118_RS11610 (NCDO2118_2226) comGF 2367494..2367940 (-) 447 WP_038603761.1 competence type IV pilus minor pilin ComGF Machinery gene
  NCDO2118_RS11615 (NCDO2118_2227) comGE 2367903..2368199 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  NCDO2118_RS11620 (NCDO2118_2228) comGD 2368171..2368602 (-) 432 WP_012898621.1 competence type IV pilus minor pilin ComGD Machinery gene
  NCDO2118_RS11625 (NCDO2118_2229) comGC 2368562..2368945 (-) 384 WP_012898622.1 competence type IV pilus major pilin ComGC Machinery gene
  NCDO2118_RS11630 (NCDO2118_2230) comGB 2368959..2370032 (-) 1074 WP_012898623.1 competence type IV pilus assembly protein ComGB Machinery gene
  NCDO2118_RS11635 (NCDO2118_2231) comGA 2369926..2370864 (-) 939 WP_012898624.1 competence type IV pilus ATPase ComGA Machinery gene
  NCDO2118_RS11640 - 2371134..2371316 (-) 183 WP_038603763.1 hypothetical protein -
  NCDO2118_RS11645 (NCDO2118_2232) - 2371307..2372062 (-) 756 WP_012898625.1 hypothetical protein -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10826.14 Da        Isoelectric Point: 6.2158

>NTDB_id=126448 NCDO2118_RS11605 WP_012898619.1 2367171..2367455(-) (comGG) [Lactococcus lactis subsp. lactis NCDO 2118]
MFSMFLKFYLQRQIDDARQLRSEKEQLTAELMVSIALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGTNFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=126448 NCDO2118_RS11605 WP_012898619.1 2367171..2367455(-) (comGG) [Lactococcus lactis subsp. lactis NCDO 2118]
ATGTTTTCAATGTTTCTTAAGTTCTATTTGCAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACTGCTGAATTAATGGTGTCGATAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACCTATCAATTT
AGTATCCATCTAAAAGATGGCACAAACTTTCAAATAAAAAATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

59.14

98.936

0.585

Multiple sequence alignment