Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ABUW_RS02665 | Genome accession | NZ_CP008706 |
| Coordinates | 548446..548799 (-) | Length | 117 a.a. |
| NCBI ID | WP_002014678.1 | Uniprot ID | A0A0D5YEH0 |
| Organism | Acinetobacter baumannii strain AB5075-UW | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 546080..580218 | 548446..548799 | within | 0 |
Gene organization within MGE regions
Location: 546080..580218
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABUW_RS02645 (ABUW_0538) | - | 546080..547147 (+) | 1068 | WP_000107855.1 | site-specific integrase | - |
| ABUW_RS02650 (ABUW_0539) | - | 547175..547471 (-) | 297 | WP_000218943.1 | hypothetical protein | - |
| ABUW_RS02655 (ABUW_0540) | - | 547468..547689 (-) | 222 | WP_000424605.1 | hypothetical protein | - |
| ABUW_RS02660 (ABUW_0541) | - | 547699..548436 (-) | 738 | WP_000125747.1 | 3'-5' exonuclease | - |
| ABUW_RS02665 (ABUW_0542) | ssb | 548446..548799 (-) | 354 | WP_002014678.1 | single-stranded DNA-binding protein | Machinery gene |
| ABUW_RS02670 (ABUW_0543) | - | 548787..549104 (-) | 318 | WP_000049658.1 | hypothetical protein | - |
| ABUW_RS20420 (ABUW_0544) | - | 549097..549267 (-) | 171 | WP_001015076.1 | hypothetical protein | - |
| ABUW_RS02675 (ABUW_0545) | - | 549257..549808 (-) | 552 | WP_001178668.1 | hypothetical protein | - |
| ABUW_RS02680 (ABUW_0546) | - | 549874..550206 (-) | 333 | WP_000632296.1 | hypothetical protein | - |
| ABUW_RS02685 (ABUW_0547) | - | 550203..552941 (-) | 2739 | WP_002014340.1 | toprim domain-containing protein | - |
| ABUW_RS02690 (ABUW_0548) | - | 553035..553226 (-) | 192 | WP_001043481.1 | hypothetical protein | - |
| ABUW_RS02695 (ABUW_0549) | - | 553319..553660 (+) | 342 | WP_000786719.1 | helix-turn-helix transcriptional regulator | - |
| ABUW_RS02700 (ABUW_0550) | - | 553705..553920 (-) | 216 | WP_000556351.1 | hypothetical protein | - |
| ABUW_RS02705 (ABUW_0551) | - | 554045..554860 (-) | 816 | WP_001094886.1 | Rha family transcriptional regulator | - |
| ABUW_RS02710 (ABUW_0552) | - | 554968..555162 (-) | 195 | WP_000696053.1 | hypothetical protein | - |
| ABUW_RS02715 (ABUW_0553) | - | 555472..556350 (+) | 879 | WP_000417952.1 | BRCT domain-containing protein | - |
| ABUW_RS02720 (ABUW_0554) | - | 556350..556631 (+) | 282 | WP_000713873.1 | hypothetical protein | - |
| ABUW_RS02730 (ABUW_0555) | - | 556947..557147 (-) | 201 | WP_000130085.1 | TraR/DksA C4-type zinc finger protein | - |
| ABUW_RS02735 (ABUW_0556) | - | 557144..557383 (-) | 240 | WP_000113725.1 | ogr/Delta-like zinc finger family protein | - |
| ABUW_RS02740 (ABUW_0557) | - | 557513..558826 (-) | 1314 | WP_000483061.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| ABUW_RS02745 (ABUW_0558) | - | 558827..559267 (-) | 441 | WP_000979757.1 | phage tail protein | - |
| ABUW_RS02750 (ABUW_0559) | - | 559273..561723 (-) | 2451 | WP_000774268.1 | phage tail tape measure protein | - |
| ABUW_RS02765 (ABUW_0563) | - | 562998..563819 (+) | 822 | WP_001046004.1 | OXA-23 family carbapenem-hydrolyzing class D beta-lactamase OXA-23 | - |
| ABUW_RS02770 (ABUW_0564) | - | 563924..564676 (-) | 753 | WP_079264522.1 | DUF815 domain-containing protein | - |
| ABUW_RS02775 (ABUW_0565) | - | 564679..565020 (-) | 342 | WP_001071615.1 | phage tail assembly protein | - |
| ABUW_RS02780 (ABUW_0566) | - | 565087..565605 (-) | 519 | WP_001207612.1 | phage major tail tube protein | - |
| ABUW_RS02785 (ABUW_0567) | - | 565618..566793 (-) | 1176 | WP_000963361.1 | phage tail sheath protein | - |
| ABUW_RS02790 (ABUW_0568) | - | 566943..568895 (-) | 1953 | WP_000729646.1 | phage tail protein | - |
| ABUW_RS02795 (ABUW_0569) | - | 568907..569512 (-) | 606 | WP_001050805.1 | phage tail protein I | - |
| ABUW_RS02800 (ABUW_0570) | - | 569512..570414 (-) | 903 | WP_000109738.1 | baseplate J/gp47 family protein | - |
| ABUW_RS02805 (ABUW_0571) | - | 570411..570758 (-) | 348 | WP_000987745.1 | GPW/gp25 family protein | - |
| ABUW_RS02810 (ABUW_0572) | - | 570755..571387 (-) | 633 | WP_000990625.1 | phage baseplate assembly protein V | - |
| ABUW_RS02815 (ABUW_0573) | - | 571460..571909 (-) | 450 | WP_001059843.1 | phage virion morphogenesis protein | - |
| ABUW_RS02820 (ABUW_0574) | - | 571906..572433 (-) | 528 | WP_000742888.1 | phage tail protein | - |
| ABUW_RS02825 (ABUW_0575) | - | 572430..573260 (-) | 831 | WP_000600982.1 | N-acetylmuramidase family protein | - |
| ABUW_RS02830 (ABUW_0576) | - | 573257..573526 (-) | 270 | WP_000571491.1 | phage holin family protein | - |
| ABUW_RS02835 (ABUW_0577) | - | 573523..573873 (-) | 351 | WP_001114936.1 | putative holin | - |
| ABUW_RS02840 (ABUW_0578) | - | 573882..574091 (-) | 210 | WP_000659474.1 | tail protein X | - |
| ABUW_RS02845 (ABUW_0579) | - | 574092..574544 (-) | 453 | WP_000015691.1 | head completion/stabilization protein | - |
| ABUW_RS02850 (ABUW_0580) | gpM | 574648..575394 (-) | 747 | WP_000950641.1 | phage terminase small subunit | - |
| ABUW_RS02855 (ABUW_0581) | - | 575405..576394 (-) | 990 | WP_001243259.1 | phage major capsid protein, P2 family | - |
| ABUW_RS02860 (ABUW_0582) | - | 576447..577274 (-) | 828 | WP_000748563.1 | GPO family capsid scaffolding protein | - |
| ABUW_RS02865 (ABUW_0583) | - | 577433..579220 (+) | 1788 | WP_031946558.1 | terminase large subunit domain-containing protein | - |
| ABUW_RS02870 (ABUW_0584) | - | 579220..580218 (+) | 999 | WP_001284079.1 | phage portal protein | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13365.13 Da Isoelectric Point: 9.7939
>NTDB_id=123779 ABUW_RS02665 WP_002014678.1 548446..548799(-) (ssb) [Acinetobacter baumannii strain AB5075-UW]
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
Nucleotide
Download Length: 354 bp
>NTDB_id=123779 ABUW_RS02665 WP_002014678.1 548446..548799(-) (ssb) [Acinetobacter baumannii strain AB5075-UW]
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
55.455 |
94.017 |
0.521 |
| ssb | Vibrio cholerae strain A1552 |
54.545 |
84.615 |
0.462 |
| ssb | Neisseria gonorrhoeae MS11 |
42.857 |
89.744 |
0.385 |
| ssb | Neisseria meningitidis MC58 |
42.857 |
89.744 |
0.385 |