Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   AJ82_RS11615 Genome accession   NZ_CP007244
Coordinates   2468238..2468615 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis TrigoCor1448     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2463238..2473615
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AJ82_RS11575 (AJ82_12980) - 2463735..2464529 (+) 795 WP_014418368.1 YqhG family protein -
  AJ82_RS11580 (AJ82_12990) sinI 2464706..2464879 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  AJ82_RS11585 (AJ82_12995) sinR 2464913..2465248 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AJ82_RS11590 (AJ82_13000) - 2465296..2466081 (-) 786 WP_007408329.1 TasA family protein -
  AJ82_RS11595 (AJ82_13005) - 2466146..2466730 (-) 585 WP_025284996.1 signal peptidase I -
  AJ82_RS11600 (AJ82_13010) tapA 2466702..2467373 (-) 672 WP_025284997.1 amyloid fiber anchoring/assembly protein TapA -
  AJ82_RS11605 (AJ82_13015) - 2467632..2467961 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  AJ82_RS11610 (AJ82_13020) - 2468002..2468181 (-) 180 WP_003153093.1 YqzE family protein -
  AJ82_RS11615 (AJ82_13025) comGG 2468238..2468615 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  AJ82_RS11620 (AJ82_13030) comGF 2468616..2469116 (-) 501 WP_257726452.1 competence type IV pilus minor pilin ComGF -
  AJ82_RS11625 (AJ82_13035) comGE 2469025..2469339 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  AJ82_RS11630 (AJ82_13040) comGD 2469323..2469760 (-) 438 WP_025284999.1 competence type IV pilus minor pilin ComGD Machinery gene
  AJ82_RS11635 (AJ82_13045) comGC 2469750..2470016 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  AJ82_RS11640 (AJ82_13050) comGB 2470063..2471100 (-) 1038 WP_015240211.1 competence type IV pilus assembly protein ComGB Machinery gene
  AJ82_RS11645 (AJ82_13055) comGA 2471087..2472157 (-) 1071 WP_007612574.1 competence type IV pilus ATPase ComGA Machinery gene
  AJ82_RS11650 (AJ82_13065) - 2472351..2473301 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=118233 AJ82_RS11615 WP_012117980.1 2468238..2468615(-) (comGG) [Bacillus velezensis TrigoCor1448]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=118233 AJ82_RS11615 WP_012117980.1 2468238..2468615(-) (comGG) [Bacillus velezensis TrigoCor1448]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512


Multiple sequence alignment