Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AJ82_RS11580 | Genome accession | NZ_CP007244 |
| Coordinates | 2464706..2464879 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis TrigoCor1448 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2459706..2469879
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AJ82_RS11565 (AJ82_12970) | gcvT | 2460519..2461619 (-) | 1101 | WP_025284994.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AJ82_RS11570 (AJ82_12975) | - | 2462043..2463713 (+) | 1671 | WP_025284995.1 | SNF2-related protein | - |
| AJ82_RS11575 (AJ82_12980) | - | 2463735..2464529 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| AJ82_RS11580 (AJ82_12990) | sinI | 2464706..2464879 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| AJ82_RS11585 (AJ82_12995) | sinR | 2464913..2465248 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AJ82_RS11590 (AJ82_13000) | - | 2465296..2466081 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| AJ82_RS11595 (AJ82_13005) | - | 2466146..2466730 (-) | 585 | WP_025284996.1 | signal peptidase I | - |
| AJ82_RS11600 (AJ82_13010) | tapA | 2466702..2467373 (-) | 672 | WP_025284997.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AJ82_RS11605 (AJ82_13015) | - | 2467632..2467961 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| AJ82_RS11610 (AJ82_13020) | - | 2468002..2468181 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| AJ82_RS11615 (AJ82_13025) | comGG | 2468238..2468615 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AJ82_RS11620 (AJ82_13030) | comGF | 2468616..2469116 (-) | 501 | WP_257726452.1 | competence type IV pilus minor pilin ComGF | - |
| AJ82_RS11625 (AJ82_13035) | comGE | 2469025..2469339 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| AJ82_RS11630 (AJ82_13040) | comGD | 2469323..2469760 (-) | 438 | WP_025284999.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=118231 AJ82_RS11580 WP_003153105.1 2464706..2464879(+) (sinI) [Bacillus velezensis TrigoCor1448]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=118231 AJ82_RS11580 WP_003153105.1 2464706..2464879(+) (sinI) [Bacillus velezensis TrigoCor1448]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |