Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   AW43_RS03590 Genome accession   NZ_CP007205
Coordinates   735588..735941 (+) Length   117 a.a.
NCBI ID   WP_061406100.1    Uniprot ID   -
Organism   Pasteurella multocida subsp. multocida PMTB2.1     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 699820..739693 735588..735941 within 0


Gene organization within MGE regions


Location: 699820..739693
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AW43_RS03355 (AW43_03420) - 699820..700662 (+) 843 WP_005726500.1 patatin-like phospholipase family protein -
  AW43_RS03360 (AW43_03425) - 700934..701191 (-) 258 WP_005725695.1 hypothetical protein -
  AW43_RS03365 (AW43_03430) - 701181..701768 (-) 588 WP_081106267.1 DUF4376 domain-containing protein -
  AW43_RS03370 (AW43_03435) - 701779..703503 (-) 1725 WP_061406073.1 tail fiber protein -
  AW43_RS03375 (AW43_03440) - 703517..707164 (-) 3648 WP_061406074.1 host specificity protein J -
  AW43_RS03380 (AW43_03445) - 707168..707782 (-) 615 WP_005725307.1 tail assembly protein -
  AW43_RS03385 (AW43_03450) - 707826..708533 (-) 708 WP_005725305.1 C40 family peptidase -
  AW43_RS03390 (AW43_03455) - 708535..709185 (-) 651 WP_005725303.1 phage minor tail protein L -
  AW43_RS03395 (AW43_03460) - 709234..709788 (-) 555 WP_061406075.1 hypothetical protein -
  AW43_RS03400 (AW43_03465) - 709863..710210 (-) 348 WP_061406076.1 phage tail protein -
  AW43_RS03405 (AW43_03470) - 710210..712606 (-) 2397 WP_061406077.1 phage tail length tape measure family protein -
  AW43_RS11160 (AW43_03475) - 712593..712787 (-) 195 WP_061406078.1 hypothetical protein -
  AW43_RS03415 (AW43_03480) - 712916..713305 (-) 390 WP_061406079.1 phage minor tail protein G -
  AW43_RS03420 - 713308..713400 (-) 93 WP_391527415.1 hypothetical protein -
  AW43_RS03425 (AW43_03485) - 713409..714881 (-) 1473 WP_005725361.1 phage portal protein -
  AW43_RS03430 (AW43_03490) - 714878..715099 (-) 222 WP_042742774.1 hypothetical protein -
  AW43_RS03435 (AW43_03495) - 715096..717204 (-) 2109 WP_061406080.1 phage terminase large subunit family protein -
  AW43_RS03440 (AW43_03500) - 717207..717683 (-) 477 WP_061406081.1 DUF1441 family protein -
  AW43_RS03445 (AW43_03505) - 717974..718234 (+) 261 WP_005725369.1 type II toxin-antitoxin system RelE family toxin -
  AW43_RS03450 (AW43_03510) - 718271..718639 (+) 369 WP_014391478.1 helix-turn-helix domain-containing protein -
  AW43_RS11165 - 718663..718944 (-) 282 WP_081106269.1 hypothetical protein -
  AW43_RS03460 (AW43_03520) - 718850..719173 (-) 324 WP_005725606.1 DUF2570 family protein -
  AW43_RS03465 (AW43_03525) - 719146..719676 (-) 531 WP_005725607.1 lysozyme -
  AW43_RS03470 (AW43_03530) - 719673..719933 (-) 261 WP_014391475.1 HP1 family phage holin -
  AW43_RS03475 (AW43_03535) - 720051..720461 (+) 411 WP_061406082.1 hypothetical protein -
  AW43_RS03480 (AW43_03540) - 720556..721176 (-) 621 WP_061406083.1 KilA-N domain-containing protein -
  AW43_RS03485 (AW43_03550) - 721464..722039 (-) 576 WP_061406084.1 hypothetical protein -
  AW43_RS03490 (AW43_03555) - 722049..722966 (-) 918 WP_080527702.1 DUF4747 family protein -
  AW43_RS03495 (AW43_03560) - 723043..723408 (-) 366 WP_061406085.1 antiterminator Q family protein -
  AW43_RS03500 (AW43_03565) - 723408..724007 (-) 600 WP_061406086.1 recombination protein NinG -
  AW43_RS03505 (AW43_03570) - 724090..724506 (-) 417 WP_005725600.1 recombination protein NinB -
  AW43_RS03510 (AW43_03575) - 724509..725867 (-) 1359 WP_061406087.1 replicative DNA helicase -
  AW43_RS03515 (AW43_03580) - 725864..726682 (-) 819 WP_005725515.1 hypothetical protein -
  AW43_RS03520 (AW43_03585) - 726760..727005 (-) 246 WP_005725517.1 helix-turn-helix domain-containing protein -
  AW43_RS03525 (AW43_03590) - 727050..727325 (-) 276 WP_061406088.1 phBC6A51 family helix-turn-helix protein -
  AW43_RS03530 (AW43_03595) - 727347..727553 (-) 207 WP_061406089.1 helix-turn-helix transcriptional regulator -
  AW43_RS03535 (AW43_03600) - 727692..728327 (+) 636 WP_014391095.1 LexA family transcriptional regulator -
  AW43_RS03540 (AW43_03605) - 728473..729081 (+) 609 WP_061406090.1 hypothetical protein -
  AW43_RS03545 (AW43_03610) - 729084..729986 (+) 903 WP_061406091.1 hypothetical protein -
  AW43_RS03550 (AW43_03615) - 730240..730776 (-) 537 WP_061406092.1 hypothetical protein -
  AW43_RS03555 (AW43_03620) - 731034..731261 (+) 228 WP_061406093.1 hypothetical protein -
  AW43_RS11005 - 731406..731582 (+) 177 WP_156694309.1 hypothetical protein -
  AW43_RS03560 (AW43_03630) - 731577..732461 (-) 885 WP_061406094.1 DUF4393 domain-containing protein -
  AW43_RS03565 (AW43_03635) - 732636..732899 (+) 264 WP_061406095.1 hypothetical protein -
  AW43_RS03570 (AW43_03640) - 732989..733525 (-) 537 WP_061406096.1 hypothetical protein -
  AW43_RS03575 (AW43_03650) - 733870..734505 (+) 636 WP_061406097.1 Bro-N domain-containing protein -
  AW43_RS03580 (AW43_03655) - 734591..734848 (+) 258 WP_061406098.1 hypothetical protein -
  AW43_RS03585 (AW43_03660) - 735041..735604 (+) 564 WP_061406099.1 hypothetical protein -
  AW43_RS03590 (AW43_03665) ssb 735588..735941 (+) 354 WP_061406100.1 single-stranded DNA-binding protein Machinery gene
  AW43_RS03595 (AW43_03670) - 736085..736510 (+) 426 WP_061406101.1 hypothetical protein -
  AW43_RS03600 (AW43_03675) - 736513..737223 (+) 711 WP_061406102.1 hypothetical protein -
  AW43_RS03605 (AW43_03680) - 737689..738351 (+) 663 WP_061406103.1 Bro-N domain-containing protein -
  AW43_RS03610 (AW43_03685) - 738411..738662 (+) 252 WP_042742798.1 DUF4224 domain-containing protein -
  AW43_RS11070 (AW43_11295) - 738664..739011 (+) 348 WP_061406104.1 phage integrase Arm DNA-binding domain-containing protein -
  AW43_RS11075 - 739083..739376 (+) 294 WP_232504668.1 hypothetical protein -
  AW43_RS11080 - 739394..739693 (+) 300 WP_315591394.1 tyrosine-type recombinase/integrase -

Sequence

Protein


Download         Length: 117 a.a.        Molecular weight: 13377.97 Da        Isoelectric Point: 8.8818

>NTDB_id=117710 AW43_RS03590 WP_061406100.1 735588..735941(+) (ssb) [Pasteurella multocida subsp. multocida PMTB2.1]
MAGVNKAIIVGNLGNDPEIRTMPNGEAVTKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQAQ

Nucleotide


Download         Length: 354 bp        

>NTDB_id=117710 AW43_RS03590 WP_061406100.1 735588..735941(+) (ssb) [Pasteurella multocida subsp. multocida PMTB2.1]
ATGGCTGGCGTGAATAAAGCAATTATTGTCGGAAATTTAGGTAATGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
AGTAACAAAAATTAGTGTGGCCACGAGCGAAAGTTGGATCGACAAAAACACGAACGAGCGAAAAACGCAGACAGAATGGC
ACTCTATCGTGTTTTATCGCCGTCAAGCAGAAATTTGCGGGCAGTATCTCAAGAAAGGCTCAAAAGTGTATGTTGAAGGT
CGTTTAAAAACCCGTAAATGGCAAGACCAAAATGGGCAAGATCGCTACACTACCGAGATTCAAGGCGATGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCGCAAGCACAGTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-108)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

82.883

94.872

0.786
  ssb Vibrio cholerae strain A1552

59.292

96.581

0.573
  ssb Neisseria meningitidis MC58

52.252

94.872

0.496
  ssb Neisseria gonorrhoeae MS11

52.252

94.872

0.496

Multiple sequence alignment