Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   AW03_RS12070 Genome accession   NZ_CP007173
Coordinates   2359886..2360269 (-) Length   127 a.a.
NCBI ID   WP_015384087.1    Uniprot ID   -
Organism   Bacillus subtilis HJ5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2354886..2365269
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AW03_RS12030 (AW03_023180) sinI 2355819..2355992 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  AW03_RS12035 (AW03_023190) sinR 2356026..2356382 (+) 357 WP_080341612.1 transcriptional regulator SinR Regulator
  AW03_RS12040 (AW03_023200) tasA 2356455..2357240 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  AW03_RS12045 (AW03_023210) sipW 2357304..2357876 (-) 573 WP_080030740.1 signal peptidase I SipW -
  AW03_RS12050 (AW03_023220) tapA 2357860..2358621 (-) 762 WP_015384085.1 amyloid fiber anchoring/assembly protein TapA -
  AW03_RS12055 (AW03_023230) yqzG 2358891..2359217 (+) 327 WP_015384086.1 YqzG/YhdC family protein -
  AW03_RS12060 (AW03_023240) spoIITA 2359259..2359438 (-) 180 WP_003230176.1 YqzE family protein -
  AW03_RS12065 (AW03_023250) comGG 2359511..2359885 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  AW03_RS12070 comGF 2359886..2360269 (-) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  AW03_RS12075 (AW03_023270) comGE 2360295..2360642 (-) 348 WP_015384088.1 ComG operon protein 5 Machinery gene
  AW03_RS12080 (AW03_023280) comGD 2360626..2361057 (-) 432 WP_015384089.1 comG operon protein ComGD Machinery gene
  AW03_RS12085 (AW03_023290) comGC 2361047..2361343 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  AW03_RS12090 (AW03_023300) comGB 2361357..2362394 (-) 1038 WP_015483430.1 comG operon protein ComGB Machinery gene
  AW03_RS12095 (AW03_023310) comGA 2362381..2363451 (-) 1071 WP_015483431.1 competence protein ComGA Machinery gene
  AW03_RS12105 (AW03_023320) corA 2363861..2364814 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14293.34 Da        Isoelectric Point: 5.1404

>NTDB_id=117049 AW03_RS12070 WP_015384087.1 2359886..2360269(-) (comGF) [Bacillus subtilis HJ5]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEDGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=117049 AW03_RS12070 WP_015384087.1 2359886..2360269(-) (comGF) [Bacillus subtilis HJ5]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGGATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCACTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment