Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AW03_RS12030 Genome accession   NZ_CP007173
Coordinates   2355819..2355992 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis HJ5     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2350819..2360992
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AW03_RS12015 (AW03_023150) gcvT 2351618..2352706 (-) 1089 WP_015384081.1 glycine cleavage system aminomethyltransferase GcvT -
  AW03_RS12020 (AW03_023160) hepAA 2353148..2354821 (+) 1674 WP_015384082.1 SNF2-related protein -
  AW03_RS12025 (AW03_023170) yqhG 2354842..2355636 (+) 795 WP_003230200.1 YqhG family protein -
  AW03_RS12030 (AW03_023180) sinI 2355819..2355992 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  AW03_RS12035 (AW03_023190) sinR 2356026..2356382 (+) 357 WP_080341612.1 transcriptional regulator SinR Regulator
  AW03_RS12040 (AW03_023200) tasA 2356455..2357240 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  AW03_RS12045 (AW03_023210) sipW 2357304..2357876 (-) 573 WP_080030740.1 signal peptidase I SipW -
  AW03_RS12050 (AW03_023220) tapA 2357860..2358621 (-) 762 WP_015384085.1 amyloid fiber anchoring/assembly protein TapA -
  AW03_RS12055 (AW03_023230) yqzG 2358891..2359217 (+) 327 WP_015384086.1 YqzG/YhdC family protein -
  AW03_RS12060 (AW03_023240) spoIITA 2359259..2359438 (-) 180 WP_003230176.1 YqzE family protein -
  AW03_RS12065 (AW03_023250) comGG 2359511..2359885 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  AW03_RS12070 comGF 2359886..2360269 (-) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  AW03_RS12075 (AW03_023270) comGE 2360295..2360642 (-) 348 WP_015384088.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=117046 AW03_RS12030 WP_003230187.1 2355819..2355992(+) (sinI) [Bacillus subtilis HJ5]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=117046 AW03_RS12030 WP_003230187.1 2355819..2355992(+) (sinI) [Bacillus subtilis HJ5]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment