Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | Z042_RS08360 | Genome accession | NZ_CP007044 |
| Coordinates | 1878200..1878739 (+) | Length | 179 a.a. |
| NCBI ID | WP_024914125.1 | Uniprot ID | W0LBZ8 |
| Organism | Chania multitudinisentens RB-25 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1846009..1920124 | 1878200..1878739 | within | 0 |
Gene organization within MGE regions
Location: 1846009..1920124
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Z042_RS08185 (Z042_07735) | - | 1846165..1847121 (+) | 957 | WP_024914092.1 | ParA family protein | - |
| Z042_RS08190 (Z042_25660) | - | 1847329..1847739 (-) | 411 | WP_024914093.1 | hypothetical protein | - |
| Z042_RS08195 (Z042_07725) | dnaB | 1847937..1849307 (+) | 1371 | WP_037407344.1 | replicative DNA helicase | - |
| Z042_RS08200 (Z042_07720) | - | 1849323..1851056 (+) | 1734 | WP_051506732.1 | ParB family protein | - |
| Z042_RS08205 (Z042_07715) | - | 1851169..1851450 (+) | 282 | WP_154666903.1 | hypothetical protein | - |
| Z042_RS08210 (Z042_07710) | - | 1851447..1851686 (+) | 240 | WP_236849229.1 | TraR/DksA family transcriptional regulator | - |
| Z042_RS08215 (Z042_07705) | - | 1851785..1851961 (+) | 177 | WP_236849230.1 | hypothetical protein | - |
| Z042_RS08220 (Z042_07700) | - | 1851954..1852310 (+) | 357 | WP_024914097.1 | DUF7446 family protein | - |
| Z042_RS08225 (Z042_07695) | - | 1852324..1852878 (+) | 555 | WP_024914098.1 | hypothetical protein | - |
| Z042_RS08230 (Z042_07690) | - | 1852875..1853498 (+) | 624 | WP_024914099.1 | DUF2857 domain-containing protein | - |
| Z042_RS08235 (Z042_25665) | - | 1853495..1854838 (+) | 1344 | WP_024914100.1 | STY4528 family pathogenicity island replication protein | - |
| Z042_RS08240 (Z042_25670) | - | 1854840..1855196 (+) | 357 | WP_236849231.1 | hypothetical protein | - |
| Z042_RS08245 (Z042_07675) | - | 1855205..1855438 (+) | 234 | WP_154666905.1 | hypothetical protein | - |
| Z042_RS08250 (Z042_07670) | - | 1855511..1855768 (+) | 258 | WP_024914103.1 | hypothetical protein | - |
| Z042_RS08255 (Z042_07665) | - | 1855880..1856197 (-) | 318 | Protein_1627 | Tn3 family transposase | - |
| Z042_RS08260 (Z042_07655) | - | 1857424..1858131 (+) | 708 | WP_024914105.1 | DUF1120 domain-containing protein | - |
| Z042_RS08265 (Z042_07650) | - | 1858255..1858953 (+) | 699 | WP_024914106.1 | fimbria/pilus chaperone family protein | - |
| Z042_RS08270 (Z042_07645) | - | 1858975..1861413 (+) | 2439 | WP_024914107.1 | fimbria/pilus outer membrane usher protein | - |
| Z042_RS08275 (Z042_07640) | - | 1861427..1862002 (+) | 576 | WP_024914108.1 | hypothetical protein | - |
| Z042_RS26505 | - | 1862366..1863874 (+) | 1509 | WP_024914109.1 | TcpQ domain-containing protein | - |
| Z042_RS08290 (Z042_07630) | pilM | 1863874..1864311 (+) | 438 | WP_024914110.1 | type IV pilus biogenesis protein PilM | - |
| Z042_RS08295 (Z042_07625) | - | 1864325..1866013 (+) | 1689 | WP_024914111.1 | PilN family type IVB pilus formation outer membrane protein | - |
| Z042_RS26725 | pilO2 | 1866025..1866789 (+) | 765 | WP_051506733.1 | type 4b pilus protein PilO2 | - |
| Z042_RS26730 (Z042_25685) | pilO2 | 1866738..1867292 (+) | 555 | WP_081758492.1 | type 4b pilus protein PilO2 | - |
| Z042_RS08305 (Z042_07610) | pilP | 1867375..1867713 (+) | 339 | WP_162149759.1 | type IV pilus biogenesis protein PilP | - |
| Z042_RS08310 (Z042_07605) | - | 1867713..1869305 (+) | 1593 | WP_024914115.1 | GspE/PulE family protein | - |
| Z042_RS08315 (Z042_07600) | - | 1869298..1870383 (+) | 1086 | WP_051506734.1 | type II secretion system F family protein | - |
| Z042_RS08320 (Z042_07595) | - | 1870399..1871043 (+) | 645 | WP_024914117.1 | type 4 pilus major pilin | - |
| Z042_RS08325 (Z042_07590) | - | 1871104..1871493 (+) | 390 | WP_024914118.1 | hypothetical protein | - |
| Z042_RS08330 (Z042_07585) | - | 1871493..1871969 (+) | 477 | WP_037407348.1 | lytic transglycosylase domain-containing protein | - |
| Z042_RS08335 (Z042_07580) | - | 1871966..1872664 (+) | 699 | WP_154666907.1 | prepilin peptidase | - |
| Z042_RS08340 (Z042_07575) | pilV | 1872683..1874074 (+) | 1392 | WP_024914121.1 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| Z042_RS08345 (Z042_07570) | - | 1874350..1875177 (+) | 828 | WP_024914122.1 | PFL_4669 family integrating conjugative element protein | - |
| Z042_RS08350 (Z042_07565) | - | 1875183..1877189 (+) | 2007 | WP_024914123.1 | DNA topoisomerase III | - |
| Z042_RS08355 (Z042_07560) | - | 1877632..1878102 (+) | 471 | WP_024914124.1 | STY4534 family ICE replication protein | - |
| Z042_RS08360 (Z042_07555) | ssb | 1878200..1878739 (+) | 540 | WP_024914125.1 | single-stranded DNA-binding protein | Machinery gene |
| Z042_RS24895 | - | 1878750..1878947 (+) | 198 | WP_025297179.1 | hypothetical protein | - |
| Z042_RS08365 (Z042_07545) | - | 1879617..1880543 (+) | 927 | WP_024914126.1 | hypothetical protein | - |
| Z042_RS08370 (Z042_07540) | tnpB | 1880920..1881126 (-) | 207 | Protein_1651 | IS66 family insertion sequence element accessory protein TnpB | - |
| Z042_RS08375 (Z042_07535) | - | 1881442..1882350 (-) | 909 | WP_024914128.1 | LysR substrate-binding domain-containing protein | - |
| Z042_RS24900 | - | 1882792..1883562 (-) | 771 | WP_154666908.1 | helix-turn-helix transcriptional regulator | - |
| Z042_RS25910 | - | 1883609..1884622 (-) | 1014 | WP_154666911.1 | hypothetical protein | - |
| Z042_RS08385 (Z042_07520) | - | 1884713..1885234 (-) | 522 | WP_037407352.1 | hypothetical protein | - |
| Z042_RS08390 (Z042_07515) | - | 1885237..1885932 (-) | 696 | WP_024914131.1 | molecular chaperone | - |
| Z042_RS08395 (Z042_07510) | - | 1885901..1886575 (-) | 675 | WP_037407420.1 | pilus assembly protein | - |
| Z042_RS08400 (Z042_07505) | - | 1886637..1888889 (-) | 2253 | WP_024914133.1 | TcfC E-set like domain-containing protein | - |
| Z042_RS08405 (Z042_07500) | - | 1889146..1889649 (-) | 504 | WP_024914134.1 | CS1 type fimbrial major subunit | - |
| Z042_RS26840 (Z042_25690) | - | 1890731..1890890 (-) | 160 | Protein_1660 | IS1-like element transposase | - |
| Z042_RS26845 | - | 1891023..1891076 (+) | 54 | Protein_1661 | ESPR-type extended signal peptide-containing protein | - |
| Z042_RS26520 | - | 1891312..1891467 (+) | 156 | WP_236849233.1 | hypothetical protein | - |
| Z042_RS08415 (Z042_07485) | - | 1891449..1904774 (+) | 13326 | WP_025297177.1 | autotransporter-associated beta strand repeat-containing protein | - |
| Z042_RS08420 (Z042_07480) | - | 1904857..1905087 (-) | 231 | WP_024914248.1 | hypothetical protein | - |
| Z042_RS26525 | - | 1905149..1905592 (-) | 444 | WP_236849234.1 | hypothetical protein | - |
| Z042_RS26530 | - | 1905632..1906063 (-) | 432 | WP_236849235.1 | LysR family transcriptional regulator | - |
| Z042_RS24470 | - | 1907131..1907334 (-) | 204 | WP_024914249.1 | hypothetical protein | - |
| Z042_RS25920 | - | 1907471..1908313 (-) | 843 | WP_024914250.1 | hypothetical protein | - |
| Z042_RS08435 (Z042_07465) | - | 1909112..1910014 (+) | 903 | WP_024914252.1 | hypothetical protein | - |
| Z042_RS08440 (Z042_25705) | - | 1910025..1910780 (+) | 756 | WP_236849236.1 | TIGR03759 family integrating conjugative element protein | - |
| Z042_RS08445 (Z042_07455) | - | 1910828..1911394 (+) | 567 | WP_045784862.1 | transglycosylase SLT domain-containing protein | - |
| Z042_RS08450 (Z042_07450) | - | 1911394..1911909 (+) | 516 | WP_037407524.1 | integrating conjugative element protein | - |
| Z042_RS08455 (Z042_25710) | - | 1911993..1912574 (+) | 582 | WP_236849237.1 | restriction endonuclease | - |
| Z042_RS08460 (Z042_07440) | traD | 1912567..1914618 (+) | 2052 | WP_024914257.1 | type IV conjugative transfer system coupling protein TraD | - |
| Z042_RS08465 (Z042_07435) | - | 1914725..1915207 (+) | 483 | WP_236849258.1 | TIGR03747 family integrating conjugative element membrane protein | - |
| Z042_RS26535 | - | 1915163..1915384 (-) | 222 | Protein_1676 | conjugal transfer protein TraF | - |
| Z042_RS24485 | - | 1915643..1916278 (-) | 636 | WP_154666912.1 | hypothetical protein | - |
| Z042_RS25925 | - | 1916273..1916476 (+) | 204 | WP_154666914.1 | hypothetical protein | - |
| Z042_RS25930 | - | 1916927..1917127 (+) | 201 | WP_154666924.1 | hypothetical protein | - |
| Z042_RS08480 (Z042_25720) | - | 1917733..1918644 (+) | 912 | WP_162149763.1 | TraI domain-containing protein | - |
| Z042_RS26265 (Z042_07410) | - | 1918641..1918880 (+) | 240 | WP_167336759.1 | hypothetical protein | - |
| Z042_RS08490 (Z042_07405) | - | 1918858..1919838 (+) | 981 | WP_024914263.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 179 a.a. Molecular weight: 19413.46 Da Isoelectric Point: 6.8627
>NTDB_id=116300 Z042_RS08360 WP_024914125.1 1878200..1878739(+) (ssb) [Chania multitudinisentens RB-25]
MASRGVNKVILVGNLGQDPDVRYMPNGGAVATLSLATSESWRDKATGEQKECTEWHRVVIFGKLAEVAGEYLRKGSQIYI
EGQLRTRKWQDQSGQDRYTTEVNVGQSGTMQMLGSRPQNSSGAGTNAPQGGWGQPQQPTHSGQPPQQSAGNEPPMDFDDD
IPFAPRGHGVARHCLYATS
MASRGVNKVILVGNLGQDPDVRYMPNGGAVATLSLATSESWRDKATGEQKECTEWHRVVIFGKLAEVAGEYLRKGSQIYI
EGQLRTRKWQDQSGQDRYTTEVNVGQSGTMQMLGSRPQNSSGAGTNAPQGGWGQPQQPTHSGQPPQQSAGNEPPMDFDDD
IPFAPRGHGVARHCLYATS
Nucleotide
Download Length: 540 bp
>NTDB_id=116300 Z042_RS08360 WP_024914125.1 1878200..1878739(+) (ssb) [Chania multitudinisentens RB-25]
ATGGCATCACGCGGCGTCAACAAAGTCATTTTAGTGGGTAATCTGGGTCAGGATCCGGATGTACGGTATATGCCGAACGG
GGGGGCGGTGGCAACCTTGTCACTGGCCACCTCGGAGTCCTGGCGTGACAAAGCCACCGGTGAGCAGAAAGAGTGCACCG
AATGGCACCGGGTGGTCATCTTCGGCAAGCTGGCTGAAGTGGCGGGCGAATACTTGCGCAAAGGCTCTCAAATCTACATT
GAGGGCCAGTTACGGACCCGGAAGTGGCAGGATCAGTCCGGTCAGGATCGTTACACCACCGAAGTCAATGTCGGGCAGAG
TGGGACGATGCAGATGCTGGGTAGCCGGCCACAGAACAGCAGTGGTGCGGGAACGAACGCCCCGCAGGGCGGTTGGGGGC
AACCTCAGCAGCCGACACACAGCGGGCAACCGCCACAGCAGTCTGCCGGCAATGAACCGCCGATGGATTTTGACGACGAC
ATCCCGTTCGCTCCGCGGGGCCACGGTGTCGCACGACATTGTCTCTACGCGACGTCCTGA
ATGGCATCACGCGGCGTCAACAAAGTCATTTTAGTGGGTAATCTGGGTCAGGATCCGGATGTACGGTATATGCCGAACGG
GGGGGCGGTGGCAACCTTGTCACTGGCCACCTCGGAGTCCTGGCGTGACAAAGCCACCGGTGAGCAGAAAGAGTGCACCG
AATGGCACCGGGTGGTCATCTTCGGCAAGCTGGCTGAAGTGGCGGGCGAATACTTGCGCAAAGGCTCTCAAATCTACATT
GAGGGCCAGTTACGGACCCGGAAGTGGCAGGATCAGTCCGGTCAGGATCGTTACACCACCGAAGTCAATGTCGGGCAGAG
TGGGACGATGCAGATGCTGGGTAGCCGGCCACAGAACAGCAGTGGTGCGGGAACGAACGCCCCGCAGGGCGGTTGGGGGC
AACCTCAGCAGCCGACACACAGCGGGCAACCGCCACAGCAGTCTGCCGGCAATGAACCGCCGATGGATTTTGACGACGAC
ATCCCGTTCGCTCCGCGGGGCCACGGTGTCGCACGACATTGTCTCTACGCGACGTCCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
72.316 |
98.883 |
0.715 |
| ssb | Glaesserella parasuis strain SC1401 |
58.011 |
100 |
0.587 |
| ssb | Neisseria meningitidis MC58 |
42.614 |
98.324 |
0.419 |
| ssb | Neisseria gonorrhoeae MS11 |
41.899 |
100 |
0.419 |