Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | PMCN07_RS01165 | Genome accession | NZ_CP007040 |
| Coordinates | 235594..236016 (-) | Length | 140 a.a. |
| NCBI ID | WP_050951544.1 | Uniprot ID | A0A5C6GZH4 |
| Organism | Pasteurella multocida subsp. multocida str. HN07 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 188746..243668 | 235594..236016 | within | 0 |
Gene organization within MGE regions
Location: 188746..243668
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PMCN07_RS00875 (PMCN07_0167) | - | 189005..189847 (-) | 843 | WP_011271867.1 | tyrosine-type recombinase/integrase | - |
| PMCN07_RS00880 (PMCN07_0168) | mobH | 189908..191809 (-) | 1902 | WP_076090444.1 | MobH family relaxase | - |
| PMCN07_RS00890 (PMCN07_0169) | - | 192108..192716 (+) | 609 | WP_076090446.1 | hypothetical protein | - |
| PMCN07_RS00895 | - | 192811..193128 (-) | 318 | WP_231116306.1 | hypothetical protein | - |
| PMCN07_RS00900 (PMCN07_0170) | - | 193347..193538 (+) | 192 | WP_005653495.1 | hypothetical protein | - |
| PMCN07_RS00905 (PMCN07_0171) | - | 193553..194143 (+) | 591 | WP_020910025.1 | recombinase family protein | - |
| PMCN07_RS00910 (PMCN07_0172) | - | 194745..195506 (-) | 762 | WP_020910027.1 | N-6 DNA methylase | - |
| PMCN07_RS00915 (PMCN07_0173) | - | 195610..196563 (-) | 954 | WP_020910028.1 | ArdC family protein | - |
| PMCN07_RS11040 (PMCN07_0174) | - | 196694..196852 (-) | 159 | WP_005667862.1 | hypothetical protein | - |
| PMCN07_RS00920 (PMCN07_0175) | - | 196856..197104 (-) | 249 | WP_005687602.1 | hypothetical protein | - |
| PMCN07_RS00925 (PMCN07_0176) | - | 197107..197340 (-) | 234 | WP_005653503.1 | hypothetical protein | - |
| PMCN07_RS00930 (PMCN07_0177) | - | 197425..197781 (-) | 357 | WP_044509376.1 | hypothetical protein | - |
| PMCN07_RS00935 (PMCN07_0178) | - | 198162..198599 (+) | 438 | WP_020910030.1 | TIGR03757 family integrating conjugative element protein | - |
| PMCN07_RS00940 (PMCN07_0179) | - | 198596..199537 (+) | 942 | WP_005687598.1 | TIGR03756 family integrating conjugative element protein | - |
| PMCN07_RS00945 (PMCN07_0180) | - | 199552..201552 (+) | 2001 | WP_005687597.1 | integrating conjugative element protein | - |
| PMCN07_RS00950 (PMCN07_0181) | - | 201568..201975 (+) | 408 | WP_005667853.1 | hypothetical protein | - |
| PMCN07_RS00955 (PMCN07_0182) | - | 202020..202199 (-) | 180 | WP_047922037.1 | hypothetical protein | - |
| PMCN07_RS00960 (PMCN07_0183) | - | 202396..202752 (+) | 357 | WP_047922052.1 | hypothetical protein | - |
| PMCN07_RS00965 (PMCN07_0184) | - | 202779..204275 (-) | 1497 | WP_040975703.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| PMCN07_RS00970 (PMCN07_0185) | - | 204284..204607 (-) | 324 | WP_005667837.1 | hypothetical protein | - |
| PMCN07_RS00975 (PMCN07_0186) | - | 204617..205060 (-) | 444 | WP_005687593.1 | hypothetical protein | - |
| PMCN07_RS00980 (PMCN07_0187) | - | 205032..207902 (-) | 2871 | WP_058230494.1 | conjugative transfer ATPase | - |
| PMCN07_RS00985 (PMCN07_0188) | - | 207918..208325 (-) | 408 | WP_005653518.1 | TIGR03751 family conjugal transfer lipoprotein | - |
| PMCN07_RS00990 (PMCN07_0189) | - | 208335..209735 (-) | 1401 | WP_005687589.1 | TIGR03752 family integrating conjugative element protein | - |
| PMCN07_RS00995 (PMCN07_0190) | - | 209746..210615 (-) | 870 | WP_047922050.1 | TIGR03749 family integrating conjugative element protein | - |
| PMCN07_RS01000 (PMCN07_0191) | - | 210615..211259 (-) | 645 | WP_047922049.1 | PFL_4703 family integrating conjugative element protein | - |
| PMCN07_RS01005 (PMCN07_0192) | - | 211271..211642 (-) | 372 | WP_011271844.1 | TIGR03750 family conjugal transfer protein | - |
| PMCN07_RS01010 (PMCN07_0193) | - | 211662..212063 (-) | 402 | WP_005653541.1 | DUF2976 domain-containing protein | - |
| PMCN07_RS01015 (PMCN07_0194) | - | 212083..212328 (-) | 246 | WP_005750915.1 | DUF3262 family protein | - |
| PMCN07_RS01020 (PMCN07_0195) | - | 212332..212652 (-) | 321 | WP_053007201.1 | RAQPRD family integrative conjugative element protein | - |
| PMCN07_RS01025 (PMCN07_0196) | - | 212813..213499 (-) | 687 | WP_012564939.1 | TIGR03747 family integrating conjugative element membrane protein | - |
| PMCN07_RS01030 (PMCN07_0197) | - | 213499..213834 (-) | 336 | WP_005687581.1 | hypothetical protein | - |
| PMCN07_RS01035 (PMCN07_0198) | traD | 213818..216067 (-) | 2250 | WP_076090459.1 | type IV conjugative transfer system coupling protein TraD | - |
| PMCN07_RS01040 (PMCN07_0199) | - | 216064..216570 (-) | 507 | WP_011271841.1 | integrating conjugative element protein | - |
| PMCN07_RS01045 (PMCN07_0200) | - | 216586..217344 (-) | 759 | WP_011271840.1 | transglycosylase SLT domain-containing protein | - |
| PMCN07_RS01050 (PMCN07_0201) | - | 217323..218063 (-) | 741 | WP_012564936.1 | TIGR03759 family integrating conjugative element protein | - |
| PMCN07_RS01055 (PMCN07_0202) | - | 218067..218696 (-) | 630 | WP_012564935.1 | lipoprotein | - |
| PMCN07_RS01060 (PMCN07_0203) | - | 218795..219526 (-) | 732 | WP_047922047.1 | TraX family protein | - |
| PMCN07_RS01065 (PMCN07_0204) | - | 219617..219820 (-) | 204 | WP_047922046.1 | hypothetical protein | - |
| PMCN07_RS01075 | - | 220099..221227 (+) | 1129 | Protein_205 | IS4 family transposase | - |
| PMCN07_RS01080 (PMCN07_0207) | - | 221237..221362 (-) | 126 | WP_001303004.1 | LysR family transcriptional regulator | - |
| PMCN07_RS01085 (PMCN07_0208) | gltS | 221593..222798 (-) | 1206 | WP_000599533.1 | sodium/glutamate symporter | - |
| PMCN07_RS01090 | - | 223242..223562 (+) | 321 | WP_000562370.1 | antibiotic biosynthesis monooxygenase family protein | - |
| PMCN07_RS01095 (PMCN07_0211) | - | 223555..223941 (+) | 387 | WP_000460651.1 | hypothetical protein | - |
| PMCN07_RS01100 (PMCN07_0212) | - | 223949..224635 (+) | 687 | WP_001284954.1 | ArsR/SmtB family transcription factor | - |
| PMCN07_RS01105 | tetR(B) | 224613..225235 (-) | 623 | Protein_211 | tetracycline resistance transcriptional repressor TetR(B) | - |
| PMCN07_RS01110 (PMCN07_0215) | tet(B) | 225317..226522 (+) | 1206 | WP_001089068.1 | tetracycline efflux MFS transporter Tet(B) | - |
| PMCN07_RS01115 (PMCN07_0216) | tetC | 226635..227228 (-) | 594 | WP_000428546.1 | tetracyline resistance-associated transcriptional repressor TetC | - |
| PMCN07_RS01120 (PMCN07_0217) | - | 227316..227732 (+) | 417 | WP_000275180.1 | helix-turn-helix domain-containing protein | - |
| PMCN07_RS01125 (PMCN07_0218) | - | 227742..228950 (-) | 1209 | WP_001339197.1 | IS4-like element ISVsa5 family transposase | - |
| PMCN07_RS01130 (PMCN07_0219) | - | 229010..229369 (-) | 360 | WP_230306568.1 | hypothetical protein | - |
| PMCN07_RS01135 (PMCN07_0220) | radC | 229462..229932 (-) | 471 | WP_012564928.1 | RadC family protein | - |
| PMCN07_RS01140 (PMCN07_0221) | - | 230071..230712 (-) | 642 | WP_047922032.1 | DUF3560 domain-containing protein | - |
| PMCN07_RS01145 (PMCN07_0222) | - | 230827..231255 (-) | 429 | WP_011271832.1 | STY4534 family ICE replication protein | - |
| PMCN07_RS01150 (PMCN07_0223) | - | 232140..234185 (-) | 2046 | WP_012564926.1 | DNA topoisomerase III | - |
| PMCN07_RS01155 (PMCN07_0224) | - | 234276..234833 (+) | 558 | WP_012564925.1 | plasmid fertility inhibition factor family protein | - |
| PMCN07_RS01160 (PMCN07_0225) | - | 235049..235567 (-) | 519 | WP_047922027.1 | membrane lipoprotein lipid attachment site-containing protein | - |
| PMCN07_RS01165 (PMCN07_0226) | ssb | 235594..236016 (-) | 423 | WP_050951544.1 | single-stranded DNA-binding protein | Machinery gene |
| PMCN07_RS01170 (PMCN07_0227) | - | 236263..236736 (-) | 474 | WP_005653583.1 | DUF3158 family protein | - |
| PMCN07_RS01175 (PMCN07_0228) | - | 236751..237506 (-) | 756 | WP_005667775.1 | PFL_4669 family integrating conjugative element protein | - |
| PMCN07_RS01185 (PMCN07_0230) | - | 237731..238954 (-) | 1224 | WP_012564922.1 | STY4528 family pathogenicity island replication protein | - |
| PMCN07_RS01190 (PMCN07_0231) | - | 239104..239655 (-) | 552 | WP_076090461.1 | DUF2857 domain-containing protein | - |
| PMCN07_RS01195 | - | 239655..241342 (-) | 1688 | Protein_228 | ParB family protein | - |
| PMCN07_RS01200 (PMCN07_0234) | dnaB | 241335..242690 (-) | 1356 | WP_012564920.1 | replicative DNA helicase | - |
| PMCN07_RS01205 (PMCN07_0235) | - | 242692..243528 (-) | 837 | WP_005653598.1 | ParA family protein | - |
Sequence
Protein
Download Length: 140 a.a. Molecular weight: 15746.57 Da Isoelectric Point: 5.7558
>NTDB_id=116214 PMCN07_RS01165 WP_050951544.1 235594..236016(-) (ssb) [Pasteurella multocida subsp. multocida str. HN07]
MAGINKVIIVGHLGNDPEMRSMPNGEAVANISVATSEAWTDKNTGERREVTEWHRIVFYRKLAEICGQYLKKGAQVYIEG
RLRTRKWQDQNGQDRYTTEIQGDVMQMLGTRPQSADGANNSQPMPQQDASANTFDDSIPF
MAGINKVIIVGHLGNDPEMRSMPNGEAVANISVATSEAWTDKNTGERREVTEWHRIVFYRKLAEICGQYLKKGAQVYIEG
RLRTRKWQDQNGQDRYTTEIQGDVMQMLGTRPQSADGANNSQPMPQQDASANTFDDSIPF
Nucleotide
Download Length: 423 bp
>NTDB_id=116214 PMCN07_RS01165 WP_050951544.1 235594..236016(-) (ssb) [Pasteurella multocida subsp. multocida str. HN07]
ATGGCTGGAATTAATAAAGTAATTATCGTGGGACATTTAGGTAATGATCCTGAAATGCGAAGCATGCCGAATGGTGAGGC
AGTTGCAAATATCAGTGTAGCAACTAGCGAAGCTTGGACGGATAAAAACACCGGTGAACGTCGTGAAGTGACTGAATGGC
ATCGAATCGTTTTTTATCGCAAATTAGCTGAAATTTGCGGTCAATACCTCAAGAAGGGAGCTCAAGTCTATATTGAAGGT
CGCTTACGTACTCGTAAATGGCAAGATCAAAACGGGCAAGATCGTTATACCACGGAAATCCAAGGTGATGTAATGCAAAT
GTTAGGTACTCGCCCTCAAAGTGCAGATGGTGCAAATAATTCTCAGCCAATGCCACAACAAGATGCATCGGCAAATACTT
TTGATGATTCAATACCATTCTGA
ATGGCTGGAATTAATAAAGTAATTATCGTGGGACATTTAGGTAATGATCCTGAAATGCGAAGCATGCCGAATGGTGAGGC
AGTTGCAAATATCAGTGTAGCAACTAGCGAAGCTTGGACGGATAAAAACACCGGTGAACGTCGTGAAGTGACTGAATGGC
ATCGAATCGTTTTTTATCGCAAATTAGCTGAAATTTGCGGTCAATACCTCAAGAAGGGAGCTCAAGTCTATATTGAAGGT
CGCTTACGTACTCGTAAATGGCAAGATCAAAACGGGCAAGATCGTTATACCACGGAAATCCAAGGTGATGTAATGCAAAT
GTTAGGTACTCGCCCTCAAAGTGCAGATGGTGCAAATAATTCTCAGCCAATGCCACAACAAGATGCATCGGCAAATACTT
TTGATGATTCAATACCATTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
55.556 |
100 |
0.714 |
| ssb | Vibrio cholerae strain A1552 |
52.023 |
100 |
0.643 |
| ssb | Neisseria meningitidis MC58 |
59.13 |
82.143 |
0.486 |
| ssb | Neisseria gonorrhoeae MS11 |
59.13 |
82.143 |
0.486 |