Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   ACI6O7_RS04815 Genome accession   NZ_OY725152
Coordinates   972956..973528 (+) Length   190 a.a.
NCBI ID   WP_404379411.1    Uniprot ID   -
Organism   Lactococcus lactis strain IMDO WA12L8     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 966147..1018259 972956..973528 within 0


Gene organization within MGE regions


Location: 966147..1018259
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACI6O7_RS04745 (LLWA12L8_FAMOGCFE_00961) - 966147..967280 (-) 1134 WP_404379392.1 tyrosine-type recombinase/integrase -
  ACI6O7_RS04750 (LLWA12L8_FAMOGCFE_00962) - 967401..968195 (-) 795 WP_404379394.1 hypothetical protein -
  ACI6O7_RS04755 (LLWA12L8_FAMOGCFE_00963) - 968251..968685 (-) 435 WP_404379396.1 hypothetical protein -
  ACI6O7_RS04760 (LLWA12L8_FAMOGCFE_00964) - 968695..969039 (-) 345 WP_306659746.1 helix-turn-helix domain-containing protein -
  ACI6O7_RS04765 (LLWA12L8_FAMOGCFE_00965) - 969319..969549 (+) 231 WP_404379398.1 hypothetical protein -
  ACI6O7_RS04770 (LLWA12L8_FAMOGCFE_00966) - 969564..969782 (+) 219 WP_404379400.1 hypothetical protein -
  ACI6O7_RS04775 (LLWA12L8_FAMOGCFE_00967) - 969792..970502 (+) 711 WP_404379402.1 ORF6C domain-containing protein -
  ACI6O7_RS04780 (LLWA12L8_FAMOGCFE_00968) - 970515..970751 (+) 237 WP_011834775.1 helix-turn-helix domain-containing protein -
  ACI6O7_RS04785 (LLWA12L8_FAMOGCFE_00969) - 970764..970931 (+) 168 WP_404379405.1 hypothetical protein -
  ACI6O7_RS04790 (LLWA12L8_FAMOGCFE_00970) - 971082..971363 (-) 282 WP_017865015.1 hypothetical protein -
  ACI6O7_RS04795 (LLWA12L8_FAMOGCFE_00971) - 971513..971713 (+) 201 WP_017865014.1 helix-turn-helix transcriptional regulator -
  ACI6O7_RS04800 (LLWA12L8_FAMOGCFE_00972) - 971713..971928 (+) 216 WP_017865013.1 DUF1408 domain-containing protein -
  ACI6O7_RS04805 (LLWA12L8_FAMOGCFE_00973) - 972046..972441 (+) 396 WP_404379407.1 hypothetical protein -
  ACI6O7_RS04810 (LLWA12L8_FAMOGCFE_00974) - 972450..972941 (+) 492 WP_404379409.1 ERF family protein -
  ACI6O7_RS04815 (LLWA12L8_FAMOGCFE_00975) ssb 972956..973528 (+) 573 WP_404379411.1 single-stranded DNA-binding protein Machinery gene
  ACI6O7_RS04820 (LLWA12L8_FAMOGCFE_00976) - 973653..974459 (+) 807 WP_404379413.1 phage replisome organizer N-terminal domain-containing protein -
  ACI6O7_RS04825 (LLWA12L8_FAMOGCFE_00977) - 974469..975359 (+) 891 WP_058218492.1 ATP-binding protein -
  ACI6O7_RS04830 (LLWA12L8_FAMOGCFE_00978) - 975368..975541 (+) 174 WP_404379415.1 hypothetical protein -
  ACI6O7_RS04835 (LLWA12L8_FAMOGCFE_00979) - 975522..975896 (+) 375 WP_404379417.1 DUF1064 domain-containing protein -
  ACI6O7_RS04840 (LLWA12L8_FAMOGCFE_00980) - 975893..976105 (+) 213 WP_404379419.1 DUF1031 family protein -
  ACI6O7_RS04845 (LLWA12L8_FAMOGCFE_00981) - 976239..976403 (+) 165 WP_404379421.1 hypothetical protein -
  ACI6O7_RS04850 (LLWA12L8_FAMOGCFE_00982) - 976378..976743 (+) 366 WP_341540735.1 DUF658 family protein -
  ACI6O7_RS04855 (LLWA12L8_FAMOGCFE_00983) - 976754..976927 (+) 174 WP_404379423.1 hypothetical protein -
  ACI6O7_RS04860 - 976970..977263 (+) 294 WP_404379425.1 hypothetical protein -
  ACI6O7_RS04865 (LLWA12L8_FAMOGCFE_00984) - 977272..977907 (+) 636 WP_404379427.1 hypothetical protein -
  ACI6O7_RS04870 (LLWA12L8_FAMOGCFE_00985) - 977918..978433 (+) 516 WP_404379429.1 DUF1642 domain-containing protein -
  ACI6O7_RS04875 (LLWA12L8_FAMOGCFE_00986) - 978430..978723 (+) 294 WP_404379431.1 hypothetical protein -
  ACI6O7_RS04880 (LLWA12L8_FAMOGCFE_00987) dut 978720..979142 (+) 423 WP_404379435.1 dUTP diphosphatase -
  ACI6O7_RS04885 (LLWA12L8_FAMOGCFE_00988) - 979145..979417 (+) 273 WP_404379437.1 hypothetical protein -
  ACI6O7_RS04890 (LLWA12L8_FAMOGCFE_00989) - 979410..979667 (+) 258 WP_404379439.1 6-O-methylguanine DNA methyltransferase -
  ACI6O7_RS04895 (LLWA12L8_FAMOGCFE_00990) - 979667..979849 (+) 183 WP_404379441.1 hypothetical protein -
  ACI6O7_RS04900 (LLWA12L8_FAMOGCFE_00991) - 979842..980204 (+) 363 WP_404379443.1 hypothetical protein -
  ACI6O7_RS04905 (LLWA12L8_FAMOGCFE_00992) - 980201..980701 (+) 501 WP_404379445.1 SAM-dependent methyltransferase -
  ACI6O7_RS04910 (LLWA12L8_FAMOGCFE_00993) - 980757..980999 (+) 243 WP_404379447.1 hypothetical protein -
  ACI6O7_RS04915 (LLWA12L8_FAMOGCFE_00994) - 980996..981178 (+) 183 WP_404379449.1 DUF1660 domain-containing protein -
  ACI6O7_RS04920 (LLWA12L8_FAMOGCFE_00995) - 981159..981371 (+) 213 WP_404379451.1 hypothetical protein -
  ACI6O7_RS04925 (LLWA12L8_FAMOGCFE_00996) - 981711..982016 (+) 306 WP_404379453.1 hypothetical protein -
  ACI6O7_RS04930 (LLWA12L8_FAMOGCFE_00997) - 982300..982572 (+) 273 WP_404379455.1 hypothetical protein -
  ACI6O7_RS04935 (LLWA12L8_FAMOGCFE_00998) - 982574..982753 (+) 180 WP_404379457.1 hypothetical protein -
  ACI6O7_RS04940 (LLWA12L8_FAMOGCFE_00999) - 982755..983069 (+) 315 WP_404379459.1 hypothetical protein -
  ACI6O7_RS04945 (LLWA12L8_FAMOGCFE_01000) - 983149..983550 (+) 402 WP_010905708.1 RinA family protein -
  ACI6O7_RS04950 (LLWA12L8_FAMOGCFE_01001) - 983928..984446 (+) 519 WP_404379709.1 HNH endonuclease -
  ACI6O7_RS04955 (LLWA12L8_FAMOGCFE_01002) - 984573..985028 (+) 456 WP_270225268.1 phage terminase small subunit P27 family -
  ACI6O7_RS04960 (LLWA12L8_FAMOGCFE_01003) - 985018..986928 (+) 1911 WP_404379462.1 terminase large subunit -
  ACI6O7_RS04965 (LLWA12L8_FAMOGCFE_01004) - 986897..987106 (+) 210 WP_340817064.1 DUF1056 family protein -
  ACI6O7_RS04970 (LLWA12L8_FAMOGCFE_01005) - 987103..988281 (+) 1179 WP_404379464.1 phage portal protein -
  ACI6O7_RS04975 (LLWA12L8_FAMOGCFE_01006) - 988324..989031 (+) 708 WP_404379466.1 head maturation protease, ClpP-related -
  ACI6O7_RS04980 (LLWA12L8_FAMOGCFE_01007) - 989043..990284 (+) 1242 WP_404379468.1 phage major capsid protein -
  ACI6O7_RS04985 (LLWA12L8_FAMOGCFE_01008) - 990300..990623 (+) 324 WP_404379470.1 head-tail connector protein -
  ACI6O7_RS04990 (LLWA12L8_FAMOGCFE_01009) - 990598..990948 (+) 351 WP_012898015.1 phage head closure protein -
  ACI6O7_RS04995 (LLWA12L8_FAMOGCFE_01010) - 990950..991456 (+) 507 WP_404379472.1 HK97 gp10 family phage protein -
  ACI6O7_RS05000 (LLWA12L8_FAMOGCFE_01011) - 991453..991848 (+) 396 WP_404379474.1 DUF806 family protein -
  ACI6O7_RS05005 (LLWA12L8_FAMOGCFE_01012) - 991879..992502 (+) 624 WP_404379476.1 phage tail protein -
  ACI6O7_RS05010 (LLWA12L8_FAMOGCFE_01013) - 992615..993030 (+) 416 Protein_960 phage tail assembly chaperone -
  ACI6O7_RS05015 (LLWA12L8_FAMOGCFE_01014) - 993255..998384 (+) 5130 WP_404379478.1 phage tail tape measure protein -
  ACI6O7_RS05020 (LLWA12L8_FAMOGCFE_01015) - 998387..999931 (+) 1545 WP_404379480.1 distal tail protein Dit -
  ACI6O7_RS05025 (LLWA12L8_FAMOGCFE_01016) - 999931..1002522 (+) 2592 WP_404379482.1 hypothetical protein -
  ACI6O7_RS05030 (LLWA12L8_FAMOGCFE_01017) - 1002534..1002761 (+) 228 WP_404379484.1 hypothetical protein -
  ACI6O7_RS05035 (LLWA12L8_FAMOGCFE_01018) - 1002773..1003093 (+) 321 WP_225513203.1 hypothetical protein -
  ACI6O7_RS05040 (LLWA12L8_FAMOGCFE_01019) - 1003095..1003556 (+) 462 WP_404379486.1 phage holin -
  ACI6O7_RS05045 (LLWA12L8_FAMOGCFE_01020) - 1003566..1004480 (+) 915 WP_404379488.1 GH25 family lysozyme -
  ACI6O7_RS05050 (LLWA12L8_FAMOGCFE_01021) - 1004484..1004609 (+) 126 WP_404379490.1 hypothetical protein -
  ACI6O7_RS05055 (LLWA12L8_FAMOGCFE_01022) - 1004692..1006305 (+) 1614 WP_404379492.1 SIR2 family protein -
  ACI6O7_RS05065 (LLWA12L8_FAMOGCFE_01025) - 1007532..1007978 (+) 447 WP_404379494.1 ASCH domain-containing protein -
  ACI6O7_RS05070 (LLWA12L8_FAMOGCFE_01026) - 1008062..1008388 (+) 327 WP_010905638.1 heavy metal-binding domain-containing protein -
  ACI6O7_RS05075 (LLWA12L8_FAMOGCFE_01027) - 1008544..1010210 (+) 1667 Protein_972 formate--tetrahydrofolate ligase -
  ACI6O7_RS05080 (LLWA12L8_FAMOGCFE_01029) - 1010337..1010912 (+) 576 WP_404379496.1 C40 family peptidase -
  ACI6O7_RS05085 (LLWA12L8_FAMOGCFE_01030) - 1011050..1011895 (+) 846 WP_023164024.1 amino acid ABC transporter substrate-binding protein -
  ACI6O7_RS05090 (LLWA12L8_FAMOGCFE_01031) - 1012163..1013050 (+) 888 WP_004255026.1 amino acid ABC transporter permease -
  ACI6O7_RS05095 (LLWA12L8_FAMOGCFE_01032) - 1013062..1013814 (+) 753 WP_004255031.1 amino acid ABC transporter ATP-binding protein -
  ACI6O7_RS05100 (LLWA12L8_FAMOGCFE_01033) - 1013816..1014043 (+) 228 WP_004255037.1 DUF4059 family protein -
  ACI6O7_RS05105 (LLWA12L8_FAMOGCFE_01034) trxB 1014238..1015164 (+) 927 WP_404379500.1 thioredoxin-disulfide reductase -
  ACI6O7_RS05110 (LLWA12L8_FAMOGCFE_01035) secG 1015307..1015555 (+) 249 WP_003130913.1 preprotein translocase subunit SecG -
  ACI6O7_RS05115 (LLWA12L8_FAMOGCFE_01036) rnr 1015806..1018259 (+) 2454 WP_038603357.1 ribonuclease R -

Sequence


Protein


Download         Length: 190 a.a.        Molecular weight: 21758.58 Da        Isoelectric Point: 6.4656

>NTDB_id=1160529 ACI6O7_RS04815 WP_404379411.1 972956..973528(+) (ssb) [Lactococcus lactis strain IMDO WA12L8]
MINNIVLVGRLTKDVELRYTPQNQATATFSLAVSRSFKNASGERETDFINCVIWRQQAENMANFTHKGSLIGITGRIQTR
NYENQQGQRIYVTEVVADSFQLLESRSQGQQQQQQGQYQGQQGNYNQNQNNYQNQGQQNTVPQQHNQGNYQRQPQGNYQN
QQQSAQQRAQQPDPNFGGAPMEINDEDLPF

Nucleotide


Download         Length: 573 bp        

>NTDB_id=1160529 ACI6O7_RS04815 WP_404379411.1 972956..973528(+) (ssb) [Lactococcus lactis strain IMDO WA12L8]
ATGATAAATAACATAGTTTTAGTCGGAAGACTAACTAAAGATGTAGAACTTAGATATACTCCACAAAATCAAGCAACAGC
AACTTTCTCGCTTGCAGTGAGTCGCTCTTTCAAAAATGCCAGTGGAGAACGTGAAACAGATTTTATTAACTGTGTTATCT
GGCGACAACAAGCTGAAAATATGGCAAATTTCACACATAAAGGAAGCTTGATTGGTATCACTGGTAGAATCCAAACTCGA
AACTATGAAAATCAACAAGGACAACGTATTTACGTTACTGAAGTTGTTGCAGATAGTTTCCAACTTCTTGAAAGTAGAAG
CCAAGGTCAACAACAGCAACAACAAGGGCAGTATCAGGGACAACAAGGGAATTACAATCAAAACCAAAATAATTACCAAA
ATCAAGGTCAACAAAATACCGTTCCACAGCAACATAACCAAGGTAACTACCAAAGACAACCTCAAGGTAATTATCAAAAT
CAGCAACAATCAGCTCAACAAAGAGCCCAACAACCTGATCCAAACTTTGGAGGTGCTCCGATGGAAATCAACGATGAAGA
CCTACCATTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

55.208

100

0.558

  ssbA Bacillus subtilis subsp. subtilis str. 168

52.083

100

0.526

  ssb Glaesserella parasuis strain SC1401

35.025

100

0.363


Multiple sequence alignment