Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   KJP43_RS13305 Genome accession   NZ_OX419579
Coordinates   2548761..2549135 (-) Length   124 a.a.
NCBI ID   WP_029726722.1    Uniprot ID   -
Organism   Bacillus subtilis isolate NRS6103     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2543761..2554135
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP43_RS13265 (NRS6103_13150) yqhG 2544092..2544886 (+) 795 WP_015714249.1 YqhG family protein -
  KJP43_RS13270 (NRS6103_13155) sinI 2545069..2545242 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP43_RS13275 (NRS6103_13160) sinR 2545276..2545611 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP43_RS13280 (NRS6103_13165) tasA 2545704..2546489 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  KJP43_RS13285 (NRS6103_13170) sipW 2546553..2547125 (-) 573 WP_072692741.1 signal peptidase I -
  KJP43_RS13290 (NRS6103_13175) tapA 2547109..2547870 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  KJP43_RS13295 (NRS6103_13180) yqzG 2548142..2548468 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP43_RS13300 (NRS6103_13185) spoIIT 2548510..2548689 (-) 180 WP_029726723.1 YqzE family protein -
  KJP43_RS13305 (NRS6103_13190) comGG 2548761..2549135 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  KJP43_RS13310 comGF 2549136..2549519 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  KJP43_RS13315 (NRS6103_13200) comGE 2549545..2549892 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  KJP43_RS13320 (NRS6103_13205) comGD 2549876..2550307 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  KJP43_RS13325 (NRS6103_13210) comGC 2550297..2550593 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  KJP43_RS13330 (NRS6103_13215) comGB 2550607..2551644 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  KJP43_RS13335 (NRS6103_13220) comGA 2551631..2552701 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  KJP43_RS13340 (NRS6103_13230) - 2552914..2553111 (-) 198 WP_029726717.1 hypothetical protein -
  KJP43_RS13345 (NRS6103_13235) corA 2553113..2554066 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14443.63 Da        Isoelectric Point: 7.8383

>NTDB_id=1157906 KJP43_RS13305 WP_029726722.1 2548761..2549135(-) (comGG) [Bacillus subtilis isolate NRS6103]
MYCTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSVRHVLEERKGQEGTEQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1157906 KJP43_RS13305 WP_029726722.1 2548761..2549135(-) (comGG) [Bacillus subtilis isolate NRS6103]
ATGTATTGTACAAGAGGGTTTATTTACCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGGTCCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGGAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.161

100

0.952

Multiple sequence alignment