Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   KJP43_RS13270 Genome accession   NZ_OX419579
Coordinates   2545069..2545242 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis isolate NRS6103     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2540069..2550242
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP43_RS13255 (NRS6103_13140) gcvT 2540869..2541957 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  KJP43_RS13260 (NRS6103_13145) yqhH 2542398..2544071 (+) 1674 WP_029726726.1 SNF2-related protein -
  KJP43_RS13265 (NRS6103_13150) yqhG 2544092..2544886 (+) 795 WP_015714249.1 YqhG family protein -
  KJP43_RS13270 (NRS6103_13155) sinI 2545069..2545242 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP43_RS13275 (NRS6103_13160) sinR 2545276..2545611 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP43_RS13280 (NRS6103_13165) tasA 2545704..2546489 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  KJP43_RS13285 (NRS6103_13170) sipW 2546553..2547125 (-) 573 WP_072692741.1 signal peptidase I -
  KJP43_RS13290 (NRS6103_13175) tapA 2547109..2547870 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  KJP43_RS13295 (NRS6103_13180) yqzG 2548142..2548468 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP43_RS13300 (NRS6103_13185) spoIIT 2548510..2548689 (-) 180 WP_029726723.1 YqzE family protein -
  KJP43_RS13305 (NRS6103_13190) comGG 2548761..2549135 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  KJP43_RS13310 comGF 2549136..2549519 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  KJP43_RS13315 (NRS6103_13200) comGE 2549545..2549892 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1157904 KJP43_RS13270 WP_003230187.1 2545069..2545242(+) (sinI) [Bacillus subtilis isolate NRS6103]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1157904 KJP43_RS13270 WP_003230187.1 2545069..2545242(+) (sinI) [Bacillus subtilis isolate NRS6103]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment