Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | KJP52_RS21355 | Genome accession | NZ_OX419575 |
| Coordinates | 4106729..4107247 (-) | Length | 172 a.a. |
| NCBI ID | WP_003219228.1 | Uniprot ID | A0A063XE16 |
| Organism | Bacillus subtilis isolate NRS6121 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 4057135..4106714 | 4106729..4107247 | flank | 15 |
Gene organization within MGE regions
Location: 4057135..4107247
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJP52_RS21020 (NRS6121_20770) | yybO | 4057550..4058857 (+) | 1308 | WP_009968439.1 | MFS transporter | - |
| KJP52_RS21025 (NRS6121_20775) | - | 4058901..4059140 (-) | 240 | WP_003244542.1 | hypothetical protein | - |
| KJP52_RS21030 | - | 4059184..4059273 (-) | 90 | Protein_4086 | hypothetical protein | - |
| KJP52_RS21035 | - | 4059306..4059491 (-) | 186 | WP_009968440.1 | hypothetical protein | - |
| KJP52_RS21040 (NRS6121_20780) | yybN | 4060619..4061056 (+) | 438 | WP_009968442.1 | DUF2712 domain-containing protein | - |
| KJP52_RS21045 (NRS6121_20785) | yybM | 4061170..4061925 (+) | 756 | WP_003244187.1 | DUF2705 family protein | - |
| KJP52_RS21050 (NRS6121_20790) | yybL | 4061915..4062625 (+) | 711 | WP_003243512.1 | WxPxxD family membrane protein | - |
| KJP52_RS21055 (NRS6121_20795) | yybK | 4062622..4063377 (+) | 756 | WP_003243304.1 | DUF2705 family protein | - |
| KJP52_RS21060 (NRS6121_20800) | yybJ | 4063374..4064030 (+) | 657 | WP_003243153.1 | ATP-binding cassette domain-containing protein | - |
| KJP52_RS21065 | - | 4064182..4064359 (+) | 178 | Protein_4093 | MFS transporter | - |
| KJP52_RS21070 (NRS6121_20805) | - | 4064405..4065193 (-) | 789 | WP_003244492.1 | hypothetical protein | - |
| KJP52_RS21075 (NRS6121_20810) | yybH | 4065261..4065650 (-) | 390 | WP_003243451.1 | nuclear transport factor 2 family protein | - |
| KJP52_RS21080 (NRS6121_20815) | yybG | 4065796..4066635 (+) | 840 | WP_003244562.1 | pentapeptide repeat-containing protein | - |
| KJP52_RS21085 (NRS6121_20820) | yybF | 4066668..4067882 (-) | 1215 | WP_003243239.1 | MFS transporter | - |
| KJP52_RS21090 (NRS6121_20825) | yybE | 4068069..4068947 (+) | 879 | WP_003242958.1 | LysR family transcriptional regulator | - |
| KJP52_RS21095 (NRS6121_20830) | yybD | 4068961..4069404 (+) | 444 | WP_003226881.1 | GNAT family N-acetyltransferase | - |
| KJP52_RS21100 (NRS6121_20835) | yybC | 4069487..4069966 (+) | 480 | WP_003243923.1 | hypothetical protein | - |
| KJP52_RS21105 | - | 4069991..4070124 (-) | 134 | Protein_4101 | LysR family transcriptional regulator | - |
| KJP52_RS21110 (NRS6121_20840) | yybB | 4070141..4070803 (-) | 663 | WP_003226877.1 | MBL fold metallo-hydrolase | - |
| KJP52_RS21115 (NRS6121_20845) | yybA | 4070950..4071402 (-) | 453 | WP_003226875.1 | MarR family transcriptional regulator | - |
| KJP52_RS21120 (NRS6121_20850) | yyaT | 4071522..4071968 (+) | 447 | WP_003243577.1 | GNAT family N-acetyltransferase | - |
| KJP52_RS21125 (NRS6121_20855) | yyaS | 4071965..4072570 (+) | 606 | WP_003244154.1 | YitT family protein | - |
| KJP52_RS21130 (NRS6121_20860) | satA | 4072665..4073186 (-) | 522 | WP_003242546.1 | streptothricin N-acetyltransferase SatA | - |
| KJP52_RS21135 (NRS6121_20865) | yyaQ | 4073597..4073953 (+) | 357 | WP_003244448.1 | MmcQ/YjbR family DNA-binding protein | - |
| KJP52_RS21140 (NRS6121_20870) | yyaP | 4074113..4074679 (+) | 567 | WP_003243497.1 | dihydrofolate reductase family protein | - |
| KJP52_RS21145 | - | 4074921..4075083 (+) | 163 | Protein_4109 | DUF255 domain-containing protein | - |
| KJP52_RS21150 (NRS6121_20875) | tet(L) | 4075186..4076562 (-) | 1377 | WP_003242953.1 | tetracycline efflux MFS transporter Tet(L) | - |
| KJP52_RS21155 (NRS6121_20885) | - | 4076911..4077150 (+) | 240 | WP_003243894.1 | DUF255 domain-containing protein | - |
| KJP52_RS21160 (NRS6121_20890) | yyaN | 4077301..4077717 (+) | 417 | WP_010886646.1 | MerR family transcriptional regulator | - |
| KJP52_RS21165 (NRS6121_20895) | yyaM | 4077714..4078631 (+) | 918 | WP_003242776.1 | EamA family transporter | - |
| KJP52_RS21170 (NRS6121_20900) | - | 4078703..4078903 (+) | 201 | WP_213384499.1 | DUF255 domain-containing protein | - |
| KJP52_RS21175 (NRS6121_20905) | - | 4078959..4080467 (+) | 1509 | WP_213384498.1 | recombinase family protein | - |
| KJP52_RS21180 (NRS6121_20910) | - | 4080544..4080930 (-) | 387 | WP_213384497.1 | cystatin-like fold lipoprotein | - |
| KJP52_RS21185 (NRS6121_20915) | - | 4080984..4081490 (-) | 507 | WP_213384496.1 | hypothetical protein | - |
| KJP52_RS21190 (NRS6121_20920) | cwlT | 4081505..4082494 (-) | 990 | WP_087961683.1 | bifunctional lytic transglycosylase/C40 family peptidase | - |
| KJP52_RS21195 (NRS6121_20925) | - | 4082491..4084941 (-) | 2451 | WP_213384495.1 | hypothetical protein | - |
| KJP52_RS21200 (NRS6121_20930) | yddF | 4084945..4085271 (-) | 327 | WP_049635835.1 | YddF family protein | - |
| KJP52_RS21205 (NRS6121_20935) | conE | 4085289..4087784 (-) | 2496 | WP_213384494.1 | ATP-binding protein | - |
| KJP52_RS21210 (NRS6121_20940) | conD | 4087672..4088196 (-) | 525 | WP_072174271.1 | conjugal transfer protein | - |
| KJP52_RS21215 (NRS6121_20945) | conC | 4088209..4088457 (-) | 249 | WP_014478915.1 | transposon conjugation system subunit ConC | - |
| KJP52_RS21220 (NRS6121_20950) | conB | 4088470..4089534 (-) | 1065 | WP_213384493.1 | conjugal transfer protein | - |
| KJP52_RS21225 (NRS6121_20955) | - | 4089562..4089711 (-) | 150 | WP_003328171.1 | hypothetical protein | - |
| KJP52_RS21230 (NRS6121_20960) | - | 4089729..4090007 (-) | 279 | WP_082170512.1 | hypothetical protein | - |
| KJP52_RS21235 (NRS6121_20965) | - | 4090020..4090337 (-) | 318 | WP_213384492.1 | hypothetical protein | - |
| KJP52_RS21240 (NRS6121_20970) | - | 4090349..4090615 (-) | 267 | WP_129093540.1 | hypothetical protein | - |
| KJP52_RS21245 (NRS6121_20975) | - | 4090608..4090859 (-) | 252 | WP_014478910.1 | DUF3850 domain-containing protein | - |
| KJP52_RS21250 (NRS6121_20985) | nicK | 4091130..4092188 (-) | 1059 | WP_213384491.1 | replication initiation factor domain-containing protein | - |
| KJP52_RS21255 (NRS6121_20990) | - | 4092181..4092987 (-) | 807 | Protein_4131 | DUF87 domain-containing protein | - |
| KJP52_RS21260 (NRS6121_20995) | - | 4092995..4094404 (-) | 1410 | WP_213384484.1 | ATP-binding protein | - |
| KJP52_RS21265 (NRS6121_21000) | - | 4094436..4094675 (-) | 240 | WP_213384483.1 | hypothetical protein | - |
| KJP52_RS21270 (NRS6121_21005) | helP | 4094705..4095085 (-) | 381 | WP_213384481.1 | YdcP family protein | - |
| KJP52_RS21275 | - | 4095102..4095248 (-) | 147 | WP_213384480.1 | hypothetical protein | - |
| KJP52_RS21280 (NRS6121_21010) | - | 4095450..4095710 (-) | 261 | WP_213384479.1 | hypothetical protein | - |
| KJP52_RS21285 | - | 4095764..4096024 (-) | 261 | WP_213384478.1 | hypothetical protein | - |
| KJP52_RS21290 (NRS6121_21015) | - | 4096021..4096200 (-) | 180 | WP_017418449.1 | hypothetical protein | - |
| KJP52_RS21295 (NRS6121_21020) | - | 4096495..4096878 (+) | 384 | WP_017418448.1 | helix-turn-helix transcriptional regulator | - |
| KJP52_RS21300 (NRS6121_21025) | - | 4096875..4097405 (+) | 531 | WP_213384476.1 | ImmA/IrrE family metallo-endopeptidase | - |
| KJP52_RS21305 (NRS6121_21035) | - | 4097517..4098731 (-) | 1215 | WP_026092273.1 | Rap family tetratricopeptide repeat protein | - |
| KJP52_RS21310 (NRS6121_21040) | - | 4099021..4099182 (+) | 162 | WP_077199439.1 | DUF255 domain-containing protein | - |
| KJP52_RS21315 (NRS6121_21045) | yyaL | 4099221..4101110 (+) | 1890 | WP_082252133.1 | thioredoxin domain-containing protein | - |
| KJP52_RS21320 (NRS6121_21050) | yyaK | 4101107..4102006 (-) | 900 | WP_003244361.1 | type II CAAX endopeptidase family protein | - |
| KJP52_RS21325 (NRS6121_21055) | yyaJ | 4102232..4103587 (+) | 1356 | WP_003243011.1 | MFS transporter | - |
| KJP52_RS21330 (NRS6121_21060) | maa | 4103621..4104175 (-) | 555 | WP_003242928.1 | sugar O-acetyltransferase | - |
| KJP52_RS21335 (NRS6121_21065) | yyaH | 4104193..4104573 (-) | 381 | WP_003244460.1 | VOC family protein | - |
| KJP52_RS21340 (NRS6121_21070) | ccpB | 4104629..4105564 (-) | 936 | WP_003243573.1 | transcriptional regulator CcpB | - |
| KJP52_RS21345 (NRS6121_21075) | xth | 4105623..4106381 (-) | 759 | WP_003243194.1 | exodeoxyribonuclease III | - |
| KJP52_RS21350 (NRS6121_21080) | rpsR | 4106446..4106685 (-) | 240 | WP_003219224.1 | 30S ribosomal protein S18 | - |
| KJP52_RS21355 (NRS6121_21085) | ssbA | 4106729..4107247 (-) | 519 | WP_003219228.1 | single-stranded DNA-binding protein SsbA | Machinery gene |
Sequence
Protein
Download Length: 172 a.a. Molecular weight: 18742.31 Da Isoelectric Point: 4.7621
>NTDB_id=1157626 KJP52_RS21355 WP_003219228.1 4106729..4107247(-) (ssbA) [Bacillus subtilis isolate NRS6121]
MLNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFTNQSGEREADFINCVTWRRQAENVANFLKKGSLAGVDGRLQTR
NYENQQGQRVFVTEVQAESVQFLEPKNGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQRRNQGNSFNDDPFANDG
KPIDISDDDLPF
MLNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFTNQSGEREADFINCVTWRRQAENVANFLKKGSLAGVDGRLQTR
NYENQQGQRVFVTEVQAESVQFLEPKNGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQRRNQGNSFNDDPFANDG
KPIDISDDDLPF
Nucleotide
Download Length: 519 bp
>NTDB_id=1157626 KJP52_RS21355 WP_003219228.1 4106729..4107247(-) (ssbA) [Bacillus subtilis isolate NRS6121]
ATGCTTAACCGAGTTGTATTAGTCGGAAGACTGACAAAAGACCCAGAGCTTCGTTATACGCCAAACGGTGCGGCTGTTGC
TACGTTTACTCTTGCTGTGAATCGTACATTTACGAACCAGTCCGGAGAACGTGAGGCCGATTTCATTAATTGTGTCACTT
GGAGAAGACAAGCCGAAAACGTTGCAAACTTCTTGAAAAAAGGAAGCCTTGCAGGCGTAGATGGCCGTTTACAAACAAGA
AACTATGAAAACCAGCAAGGACAGCGTGTCTTCGTGACAGAGGTCCAAGCTGAAAGTGTTCAATTTCTTGAGCCGAAAAA
CGGCGGCGGTTCTGGTTCAGGTGGATACAACGAAGGAAACAGCGGCGGAGGCCAGTACTTTGGCGGAGGCCAAAATGATA
ATCCATTTGGGGGAAATCAAAACAACCAGAGACGCAATCAGGGGAACAGCTTTAATGATGACCCATTTGCCAACGACGGC
AAACCGATTGACATCTCGGATGATGATCTTCCATTCTAA
ATGCTTAACCGAGTTGTATTAGTCGGAAGACTGACAAAAGACCCAGAGCTTCGTTATACGCCAAACGGTGCGGCTGTTGC
TACGTTTACTCTTGCTGTGAATCGTACATTTACGAACCAGTCCGGAGAACGTGAGGCCGATTTCATTAATTGTGTCACTT
GGAGAAGACAAGCCGAAAACGTTGCAAACTTCTTGAAAAAAGGAAGCCTTGCAGGCGTAGATGGCCGTTTACAAACAAGA
AACTATGAAAACCAGCAAGGACAGCGTGTCTTCGTGACAGAGGTCCAAGCTGAAAGTGTTCAATTTCTTGAGCCGAAAAA
CGGCGGCGGTTCTGGTTCAGGTGGATACAACGAAGGAAACAGCGGCGGAGGCCAGTACTTTGGCGGAGGCCAAAATGATA
ATCCATTTGGGGGAAATCAAAACAACCAGAGACGCAATCAGGGGAACAGCTTTAATGATGACCCATTTGCCAACGACGGC
AAACCGATTGACATCTCGGATGATGATCTTCCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.192 |
100 |
0.599 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
64.151 |
61.628 |
0.395 |
| ssb | Glaesserella parasuis strain SC1401 |
35.519 |
100 |
0.378 |