Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   KJP64_RS12275 Genome accession   NZ_OX419565
Coordinates   2398159..2398533 (-) Length   124 a.a.
NCBI ID   WP_015251714.1    Uniprot ID   -
Organism   Bacillus subtilis isolate NRS6145     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2393159..2403533
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP64_RS12235 (NRS6145_12100) yqhG 2393491..2394285 (+) 795 WP_003230200.1 YqhG family protein -
  KJP64_RS12240 (NRS6145_12105) sinI 2394468..2394641 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP64_RS12245 (NRS6145_12110) sinR 2394675..2395010 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP64_RS12250 (NRS6145_12115) tasA 2395103..2395888 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  KJP64_RS12255 (NRS6145_12120) sipW 2395952..2396524 (-) 573 WP_003246088.1 signal peptidase I -
  KJP64_RS12260 (NRS6145_12125) tapA 2396508..2397269 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  KJP64_RS12265 (NRS6145_12130) yqzG 2397541..2397867 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP64_RS12270 (NRS6145_12135) spoIIT 2397909..2398088 (-) 180 WP_003230176.1 YqzE family protein -
  KJP64_RS12275 (NRS6145_12140) comGG 2398159..2398533 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  KJP64_RS12280 comGF 2398534..2398917 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  KJP64_RS12285 (NRS6145_12150) comGE 2398943..2399290 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  KJP64_RS12290 (NRS6145_12155) comGD 2399274..2399705 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  KJP64_RS12295 (NRS6145_12160) comGC 2399695..2399991 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  KJP64_RS12300 (NRS6145_12165) comGB 2400005..2401042 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  KJP64_RS12305 (NRS6145_12170) comGA 2401029..2402099 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  KJP64_RS12310 (NRS6145_12180) - 2402312..2402509 (-) 198 WP_014480259.1 CBS domain-containing protein -
  KJP64_RS12315 (NRS6145_12185) corA 2402511..2403464 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14540.73 Da        Isoelectric Point: 8.7849

>NTDB_id=1157166 KJP64_RS12275 WP_015251714.1 2398159..2398533(-) (comGG) [Bacillus subtilis isolate NRS6145]
MYRTRGFIYPAVLFVSALVLLIVNFTAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTEQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1157166 KJP64_RS12275 WP_015251714.1 2398159..2398533(-) (comGG) [Bacillus subtilis isolate NRS6145]
ATGTACCGTACGAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTACTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATCGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGGAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAGCTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

96.774

100

0.968

Multiple sequence alignment