Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   KJP64_RS12280 Genome accession   NZ_OX419565
Coordinates   2398534..2398917 (-) Length   127 a.a.
NCBI ID   WP_015251713.1    Uniprot ID   -
Organism   Bacillus subtilis isolate NRS6145     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2393534..2403917
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP64_RS12240 (NRS6145_12105) sinI 2394468..2394641 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP64_RS12245 (NRS6145_12110) sinR 2394675..2395010 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP64_RS12250 (NRS6145_12115) tasA 2395103..2395888 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  KJP64_RS12255 (NRS6145_12120) sipW 2395952..2396524 (-) 573 WP_003246088.1 signal peptidase I -
  KJP64_RS12260 (NRS6145_12125) tapA 2396508..2397269 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  KJP64_RS12265 (NRS6145_12130) yqzG 2397541..2397867 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP64_RS12270 (NRS6145_12135) spoIIT 2397909..2398088 (-) 180 WP_003230176.1 YqzE family protein -
  KJP64_RS12275 (NRS6145_12140) comGG 2398159..2398533 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  KJP64_RS12280 comGF 2398534..2398917 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  KJP64_RS12285 (NRS6145_12150) comGE 2398943..2399290 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  KJP64_RS12290 (NRS6145_12155) comGD 2399274..2399705 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  KJP64_RS12295 (NRS6145_12160) comGC 2399695..2399991 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  KJP64_RS12300 (NRS6145_12165) comGB 2400005..2401042 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  KJP64_RS12305 (NRS6145_12170) comGA 2401029..2402099 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  KJP64_RS12310 (NRS6145_12180) - 2402312..2402509 (-) 198 WP_014480259.1 CBS domain-containing protein -
  KJP64_RS12315 (NRS6145_12185) corA 2402511..2403464 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14280.43 Da        Isoelectric Point: 6.4838

>NTDB_id=1157167 KJP64_RS12280 WP_015251713.1 2398534..2398917(-) (comGF) [Bacillus subtilis isolate NRS6145]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=1157167 KJP64_RS12280 WP_015251713.1 2398534..2398917(-) (comGF) [Bacillus subtilis isolate NRS6145]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992


Multiple sequence alignment