Detailed information
Bioinformatically predicted
Overview
| Name | comW | Type | Regulator |
| Locus tag | AD178_RS00120 | Genome accession | NZ_OX244288 |
| Coordinates | 23399..23635 (+) | Length | 78 a.a. |
| NCBI ID | WP_000939545.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain PT8105 isolate 2RLC4 | ||
| Function | stabilization and activation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 12174..78602 | 23399..23635 | within | 0 |
| IScluster/Tn | 21472..23082 | 23399..23635 | flank | 317 |
Gene organization within MGE regions
Location: 12174..78602
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AD178_RS00065 (SAMEA1463109_00013) | ftsH | 12174..14132 (+) | 1959 | WP_000744546.1 | ATP-dependent zinc metalloprotease FtsH | - |
| AD178_RS00070 (SAMEA1463109_00014) | comX/comX2 | 14254..14733 (+) | 480 | WP_000588894.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| AD178_RS00080 (SAMEA1463109_00016) | - | 14956..15909 (-) | 954 | WP_001155341.1 | IS30-like element ISSpn8 family transposase | - |
| AD178_RS00110 | - | 21472..22301 (+) | 830 | Protein_15 | IS630 family transposase | - |
| AD178_RS00115 | - | 22336..23133 (-) | 798 | Protein_16 | transposase | - |
| AD178_RS00120 (SAMEA1463109_00025) | comW | 23399..23635 (+) | 237 | WP_000939545.1 | sigma(X)-activator ComW | Regulator |
| AD178_RS00125 (SAMEA1463109_00026) | - | 23866..25152 (+) | 1287 | WP_001832534.1 | adenylosuccinate synthase | - |
| AD178_RS00130 (SAMEA1463109_00027) | - | 25394..26542 (-) | 1149 | WP_000876727.1 | site-specific integrase | - |
| AD178_RS00135 (SAMEA1463109_00028) | - | 26713..27627 (-) | 915 | WP_000690127.1 | HIRAN domain-containing protein | - |
| AD178_RS00140 (SAMEA1463109_00029) | - | 27640..28395 (-) | 756 | WP_000069476.1 | XRE family transcriptional regulator | - |
| AD178_RS00145 (SAMEA1463109_00030) | - | 28569..28775 (+) | 207 | WP_001171134.1 | helix-turn-helix transcriptional regulator | - |
| AD178_RS00150 (SAMEA1463109_00032) | - | 29083..29760 (-) | 678 | WP_000289447.1 | DUF4145 domain-containing protein | - |
| AD178_RS00155 (SAMEA1463109_00033) | - | 29815..30528 (+) | 714 | WP_001002349.1 | ORF6C domain-containing protein | - |
| AD178_RS00160 (SAMEA1463109_00034) | - | 30541..30798 (+) | 258 | WP_000370959.1 | hypothetical protein | - |
| AD178_RS00165 (SAMEA1463109_00035) | - | 30884..31204 (+) | 321 | WP_000462829.1 | hypothetical protein | - |
| AD178_RS00170 (SAMEA1463109_00036) | - | 31220..31513 (+) | 294 | WP_000391814.1 | hypothetical protein | - |
| AD178_RS00175 (SAMEA1463109_00037) | - | 31506..32333 (+) | 828 | WP_001289767.1 | phage replisome organizer N-terminal domain-containing protein | - |
| AD178_RS00180 (SAMEA1463109_00039) | - | 32473..33243 (+) | 771 | WP_000228215.1 | ATP-binding protein | - |
| AD178_RS00185 (SAMEA1463109_00040) | - | 33258..33452 (+) | 195 | WP_000470303.1 | hypothetical protein | - |
| AD178_RS00190 (SAMEA1463109_00041) | - | 33452..33679 (+) | 228 | WP_000891969.1 | hypothetical protein | - |
| AD178_RS00195 (SAMEA1463109_00043) | - | 33806..33973 (+) | 168 | WP_000233203.1 | hypothetical protein | - |
| AD178_RS00200 | - | 33960..34169 (+) | 210 | WP_000872734.1 | hypothetical protein | - |
| AD178_RS00205 (SAMEA1463109_00044) | - | 34144..34458 (+) | 315 | WP_000391850.1 | hypothetical protein | - |
| AD178_RS00210 (SAMEA1463109_00045) | - | 34460..34984 (+) | 525 | WP_001041148.1 | DUF1642 domain-containing protein | - |
| AD178_RS00215 (SAMEA1463109_00046) | - | 34984..35271 (+) | 288 | WP_000194861.1 | hypothetical protein | - |
| AD178_RS00220 (SAMEA1463109_00047) | - | 35271..35444 (+) | 174 | WP_000389222.1 | hypothetical protein | - |
| AD178_RS00225 | - | 35507..36037 (+) | 531 | Protein_38 | DNA cytosine methyltransferase | - |
| AD178_RS00230 (SAMEA1463109_00049) | - | 36074..36538 (+) | 465 | WP_000516820.1 | hypothetical protein | - |
| AD178_RS00235 (SAMEA1463109_00050) | - | 36647..37189 (+) | 543 | WP_001028147.1 | site-specific integrase | - |
| AD178_RS00240 (SAMEA1463109_00051) | - | 37742..37936 (+) | 195 | WP_001824495.1 | HNH endonuclease | - |
| AD178_RS00245 (SAMEA1463109_00052) | - | 38073..38558 (+) | 486 | WP_000601030.1 | hypothetical protein | - |
| AD178_RS00250 (SAMEA1463109_00053) | - | 38551..40263 (+) | 1713 | WP_000230006.1 | terminase TerL endonuclease subunit | - |
| AD178_RS00255 (SAMEA1463109_00054) | - | 40272..41414 (+) | 1143 | WP_001812652.1 | phage portal protein | - |
| AD178_RS00260 (SAMEA1463109_00055) | - | 41461..42003 (+) | 543 | WP_054367057.1 | HK97 family phage prohead protease | - |
| AD178_RS00265 (SAMEA1463109_00056) | - | 42017..43270 (+) | 1254 | WP_000855224.1 | phage major capsid protein | - |
| AD178_RS00270 (SAMEA1463109_00057) | - | 43296..43631 (+) | 336 | WP_000154006.1 | hypothetical protein | - |
| AD178_RS00275 (SAMEA1463109_00058) | - | 43628..43933 (+) | 306 | WP_000842790.1 | head-tail adaptor protein | - |
| AD178_RS00280 (SAMEA1463109_00059) | - | 43933..44280 (+) | 348 | WP_001074487.1 | hypothetical protein | - |
| AD178_RS00285 (SAMEA1463109_00060) | - | 44267..44611 (+) | 345 | WP_000534622.1 | HK97 gp10 family phage protein | - |
| AD178_RS00290 (SAMEA1463109_00061) | - | 44625..45293 (+) | 669 | WP_000221469.1 | hypothetical protein | - |
| AD178_RS00295 (SAMEA1463109_00062) | - | 45295..45771 (+) | 477 | WP_000591560.1 | hypothetical protein | - |
| AD178_RS00300 (SAMEA1463109_00063) | - | 45958..48696 (+) | 2739 | WP_000140775.1 | phage tail tape measure protein | - |
| AD178_RS00305 (SAMEA1463109_00064) | - | 48693..49415 (+) | 723 | WP_000161558.1 | hypothetical protein | - |
| AD178_RS00310 (SAMEA1463109_00065) | - | 49416..55820 (+) | 6405 | WP_054375635.1 | phage tail spike protein | - |
| AD178_RS11085 (SAMEA1463109_00066) | - | 55817..55933 (+) | 117 | WP_001063633.1 | hypothetical protein | - |
| AD178_RS00315 (SAMEA1463109_00067) | - | 55914..56117 (+) | 204 | WP_001091123.1 | hypothetical protein | - |
| AD178_RS00320 (SAMEA1463109_00068) | - | 56120..56470 (+) | 351 | WP_000852248.1 | hypothetical protein | - |
| AD178_RS00325 (SAMEA1463109_00069) | - | 56480..56896 (+) | 417 | WP_001165344.1 | phage holin family protein | - |
| AD178_RS00330 (SAMEA1463109_00070) | - | 56900..57232 (+) | 333 | WP_001186210.1 | phage holin | - |
| AD178_RS00335 (SAMEA1463109_00071) | - | 57236..58192 (+) | 957 | WP_000350498.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| AD178_RS00340 (SAMEA1463109_00072) | - | 58330..58509 (-) | 180 | WP_001209433.1 | hypothetical protein | - |
| AD178_RS00345 | - | 58651..58800 (-) | 150 | WP_001030863.1 | hypothetical protein | - |
| AD178_RS00350 (SAMEA1463109_00073) | tadA | 59081..59548 (+) | 468 | WP_000291870.1 | tRNA adenosine(34) deaminase TadA | - |
| AD178_RS00360 (SAMEA1463109_00075) | - | 59757..60893 (-) | 1137 | WP_226992628.1 | site-specific integrase | - |
| AD178_RS00365 (SAMEA1463109_00076) | - | 60954..62024 (-) | 1071 | WP_000401841.1 | type I restriction endonuclease | - |
| AD178_RS00370 (SAMEA1463109_00077) | - | 62041..62421 (-) | 381 | WP_000170931.1 | ImmA/IrrE family metallo-endopeptidase | - |
| AD178_RS00375 (SAMEA1463109_00078) | - | 62434..62697 (-) | 264 | WP_000285962.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| AD178_RS00380 (SAMEA1463109_00079) | - | 62697..62930 (-) | 234 | WP_000156419.1 | hypothetical protein | - |
| AD178_RS00385 (SAMEA1463109_00080) | - | 62930..63298 (-) | 369 | WP_000464160.1 | helix-turn-helix transcriptional regulator | - |
| AD178_RS00390 (SAMEA1463109_00081) | - | 63595..63726 (+) | 132 | WP_000253628.1 | hypothetical protein | - |
| AD178_RS00395 (SAMEA1463109_00082) | - | 64016..64207 (+) | 192 | WP_001112859.1 | DNA-binding protein | - |
| AD178_RS00400 (SAMEA1463109_00083) | - | 64230..64433 (+) | 204 | WP_001247549.1 | hypothetical protein | - |
| AD178_RS00405 (SAMEA1463109_00085) | - | 64588..64755 (-) | 168 | WP_000024181.1 | YjzC family protein | - |
| AD178_RS00410 (SAMEA1463109_00086) | - | 64775..65140 (+) | 366 | Protein_75 | autolysin | - |
| AD178_RS00415 (SAMEA1463109_00087) | - | 65414..65857 (+) | 444 | WP_000701990.1 | dUTP diphosphatase | - |
| AD178_RS00420 (SAMEA1463109_00088) | - | 65859..66374 (+) | 516 | WP_000691237.1 | histidine phosphatase family protein | - |
| AD178_RS00425 (SAMEA1463109_00089) | radA | 66388..67749 (+) | 1362 | WP_074017595.1 | DNA repair protein RadA | Machinery gene |
| AD178_RS00430 (SAMEA1463109_00090) | - | 67822..68319 (+) | 498 | WP_001809263.1 | carbonic anhydrase | - |
| AD178_RS00435 (SAMEA1463109_00091) | - | 68344..69127 (+) | 784 | Protein_80 | PrsW family glutamic-type intramembrane protease | - |
| AD178_RS00440 (SAMEA1463109_00092) | - | 69272..70240 (+) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| AD178_RS00445 (SAMEA1463109_00093) | - | 70374..70655 (-) | 282 | Protein_82 | ISL3 family transposase | - |
| AD178_RS11090 | - | 70782..71688 (-) | 907 | Protein_83 | Rpn family recombination-promoting nuclease/putative transposase | - |
| AD178_RS00460 (SAMEA1463109_00096) | polA | 71944..74577 (+) | 2634 | WP_001812647.1 | DNA polymerase I | - |
| AD178_RS00465 (SAMEA1463109_00097) | - | 74662..75099 (+) | 438 | WP_000076479.1 | CoA-binding protein | - |
| AD178_RS00470 (SAMEA1463109_00098) | - | 75140..75478 (+) | 339 | WP_000692964.1 | hypothetical protein | - |
| AD178_RS00475 (SAMEA1463109_00099) | - | 75507..76517 (-) | 1011 | WP_000009170.1 | YeiH family protein | - |
| AD178_RS00480 (SAMEA1463109_00100) | - | 76666..77835 (+) | 1170 | WP_000366342.1 | pyridoxal phosphate-dependent aminotransferase | - |
| AD178_RS00485 (SAMEA1463109_00101) | recO | 77832..78602 (+) | 771 | WP_000616122.1 | DNA repair protein RecO | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 9658.13 Da Isoelectric Point: 6.7051
>NTDB_id=1154298 AD178_RS00120 WP_000939545.1 23399..23635(+) (comW) [Streptococcus pneumoniae strain PT8105 isolate 2RLC4]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC
Nucleotide
Download Length: 237 bp
>NTDB_id=1154298 AD178_RS00120 WP_000939545.1 23399..23635(+) (comW) [Streptococcus pneumoniae strain PT8105 isolate 2RLC4]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAAGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAAGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comW | Streptococcus mitis SK321 |
75.641 |
100 |
0.756 |
| comW | Streptococcus mitis NCTC 12261 |
75.325 |
98.718 |
0.744 |