Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | DXE48_RS13515 | Genome accession | NZ_LT992473 |
| Coordinates | 2670192..2670662 (+) | Length | 156 a.a. |
| NCBI ID | WP_000610648.1 | Uniprot ID | A0A090M1W2 |
| Organism | Staphylococcus aureus isolate 14_5418 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2648330..2699952 | 2670192..2670662 | within | 0 |
Gene organization within MGE regions
Location: 2648330..2699952
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE48_RS13350 | groES | 2648330..2648614 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| DXE48_RS13355 | groL | 2648690..2650306 (+) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| DXE48_RS13360 | - | 2650847..2651026 (+) | 180 | WP_000201398.1 | hypothetical protein | - |
| DXE48_RS14890 | - | 2651023..2651649 (+) | 627 | WP_000216896.1 | hypothetical protein | - |
| DXE48_RS13380 | - | 2652188..2653495 (-) | 1308 | WP_001045074.1 | TrkH family potassium uptake protein | - |
| DXE48_RS13390 | - | 2653878..2655101 (-) | 1224 | WP_000206618.1 | ArgE/DapE family deacylase | - |
| DXE48_RS13395 | - | 2655533..2656588 (+) | 1056 | WP_000791397.1 | leukocidin family pore-forming toxin | - |
| DXE48_RS13400 | - | 2656610..2657626 (+) | 1017 | WP_000595612.1 | leukocidin/hemolysin toxin family protein | - |
| DXE48_RS13405 | sph | 2657888..2658712 (-) | 825 | Protein_2535 | sphingomyelin phosphodiesterase | - |
| DXE48_RS13410 | - | 2658769..2659806 (-) | 1038 | WP_000857191.1 | tyrosine-type recombinase/integrase | - |
| DXE48_RS13415 | - | 2659879..2660328 (-) | 450 | WP_231915586.1 | hypothetical protein | - |
| DXE48_RS13420 | - | 2660428..2660610 (-) | 183 | WP_000705248.1 | hypothetical protein | - |
| DXE48_RS13425 | - | 2660814..2661155 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| DXE48_RS13430 | - | 2661161..2662093 (-) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| DXE48_RS13435 | - | 2662109..2662822 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| DXE48_RS13440 | - | 2662785..2662958 (+) | 174 | WP_001801500.1 | hypothetical protein | - |
| DXE48_RS13445 | - | 2662955..2663236 (+) | 282 | WP_000854074.1 | helix-turn-helix transcriptional regulator | - |
| DXE48_RS13450 | - | 2663233..2663448 (+) | 216 | WP_001025404.1 | Thoeris anti-defense Tad2 family protein | - |
| DXE48_RS13455 | - | 2663437..2663766 (-) | 330 | WP_000128907.1 | hypothetical protein | - |
| DXE48_RS13460 | - | 2663817..2664569 (+) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| DXE48_RS13465 | - | 2664585..2664782 (+) | 198 | WP_001148862.1 | hypothetical protein | - |
| DXE48_RS13470 | - | 2664769..2665149 (-) | 381 | WP_000762519.1 | DUF2513 domain-containing protein | - |
| DXE48_RS13475 | - | 2665204..2665527 (+) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| DXE48_RS13480 | - | 2665524..2665685 (+) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| DXE48_RS13485 | - | 2665780..2666082 (+) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| DXE48_RS13490 | - | 2666087..2666347 (+) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| DXE48_RS13495 | - | 2666356..2666619 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| DXE48_RS13500 | - | 2666628..2668571 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| DXE48_RS13505 | - | 2668573..2669493 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| DXE48_RS13510 | - | 2669574..2670191 (+) | 618 | WP_114636105.1 | MBL fold metallo-hydrolase | - |
| DXE48_RS13515 | ssbA | 2670192..2670662 (+) | 471 | WP_000610648.1 | single-stranded DNA-binding protein | Machinery gene |
| DXE48_RS13520 | - | 2670692..2671585 (+) | 894 | WP_000148321.1 | DnaD domain protein | - |
| DXE48_RS13525 | - | 2671592..2671810 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| DXE48_RS13530 | - | 2671819..2672223 (+) | 405 | WP_114636106.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DXE48_RS13535 | - | 2672236..2672604 (+) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| DXE48_RS13540 | - | 2672608..2672850 (+) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| DXE48_RS13545 | - | 2672865..2673119 (+) | 255 | WP_001065097.1 | DUF1024 family protein | - |
| DXE48_RS14895 | - | 2673106..2673276 (+) | 171 | WP_000714403.1 | hypothetical protein | - |
| DXE48_RS13550 | - | 2673269..2673805 (+) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| DXE48_RS13555 | - | 2673842..2674087 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| DXE48_RS13560 | - | 2674084..2674290 (+) | 207 | WP_076686084.1 | DUF1381 domain-containing protein | - |
| DXE48_RS13565 | - | 2674287..2674673 (+) | 387 | WP_000592207.1 | hypothetical protein | - |
| DXE48_RS13570 | rinB | 2674670..2674819 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| DXE48_RS13575 | - | 2674819..2675019 (+) | 201 | WP_001622114.1 | DUF1514 family protein | - |
| DXE48_RS13580 | - | 2675047..2675463 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| DXE48_RS13585 | - | 2675695..2675994 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
| DXE48_RS13590 | - | 2676126..2676470 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| DXE48_RS13595 | - | 2676467..2678128 (+) | 1662 | WP_000625088.1 | terminase large subunit | - |
| DXE48_RS13600 | - | 2678144..2679331 (+) | 1188 | WP_000025274.1 | phage portal protein | - |
| DXE48_RS13605 | - | 2679315..2680052 (+) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| DXE48_RS13610 | - | 2680076..2681221 (+) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| DXE48_RS13615 | - | 2681241..2681525 (+) | 285 | WP_000238236.1 | hypothetical protein | - |
| DXE48_RS13620 | - | 2681515..2681799 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| DXE48_RS13625 | - | 2681783..2682145 (+) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| DXE48_RS13630 | - | 2682142..2682546 (+) | 405 | WP_114636107.1 | HK97 gp10 family phage protein | - |
| DXE48_RS13635 | - | 2682543..2682950 (+) | 408 | WP_000565498.1 | hypothetical protein | - |
| DXE48_RS13640 | - | 2682951..2683595 (+) | 645 | WP_000268733.1 | major tail protein | - |
| DXE48_RS13645 | - | 2683649..2683861 (+) | 213 | WP_078101489.1 | Ig-like domain-containing protein | - |
| DXE48_RS13650 | gpG | 2683911..2684261 (+) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| DXE48_RS15110 | gpGT | 2684312..2684449 (+) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| DXE48_RS13655 | - | 2684506..2689035 (+) | 4530 | WP_001796452.1 | phage tail tape measure protein | - |
| DXE48_RS13660 | - | 2689032..2690516 (+) | 1485 | WP_000567408.1 | phage distal tail protein | - |
| DXE48_RS13665 | - | 2690532..2694317 (+) | 3786 | WP_000582165.1 | phage tail spike protein | - |
| DXE48_RS13670 | - | 2694307..2694459 (+) | 153 | WP_001153681.1 | hypothetical protein | - |
| DXE48_RS13675 | - | 2694506..2694793 (+) | 288 | WP_001040261.1 | hypothetical protein | - |
| DXE48_RS13680 | - | 2694851..2695147 (+) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| DXE48_RS13685 | pepG1 | 2695339..2695473 (+) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| DXE48_RS13690 | - | 2695526..2695633 (-) | 108 | WP_001791821.1 | hypothetical protein | - |
| DXE48_RS13695 | - | 2695685..2695939 (+) | 255 | WP_000611512.1 | phage holin | - |
| DXE48_RS13700 | - | 2695951..2696706 (+) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DXE48_RS13705 | sak | 2696897..2697388 (+) | 492 | WP_000919350.1 | staphylokinase | - |
| DXE48_RS13715 | - | 2698035..2698373 (+) | 339 | Protein_2598 | SH3 domain-containing protein | - |
| DXE48_RS13720 | - | 2698468..2698917 (-) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| DXE48_RS13725 | scn | 2699602..2699952 (+) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=1149971 DXE48_RS13515 WP_000610648.1 2670192..2670662(+) (ssbA) [Staphylococcus aureus isolate 14_5418]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1149971 DXE48_RS13515 WP_000610648.1 2670192..2670662(+) (ssbA) [Staphylococcus aureus isolate 14_5418]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |