Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | DXE64_RS13170 | Genome accession | NZ_LT992470 |
| Coordinates | 2573912..2574382 (+) | Length | 156 a.a. |
| NCBI ID | WP_000610648.1 | Uniprot ID | A0A090M1W2 |
| Organism | Staphylococcus aureus isolate 13_LA_301 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2552050..2603672 | 2573912..2574382 | within | 0 |
Gene organization within MGE regions
Location: 2552050..2603672
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE64_RS13005 | groES | 2552050..2552334 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| DXE64_RS13010 | groL | 2552410..2554026 (+) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| DXE64_RS13015 | - | 2554567..2554746 (+) | 180 | WP_000201398.1 | hypothetical protein | - |
| DXE64_RS14915 | - | 2554743..2555369 (+) | 627 | WP_000216896.1 | hypothetical protein | - |
| DXE64_RS13035 | - | 2555908..2557215 (-) | 1308 | WP_001045074.1 | TrkH family potassium uptake protein | - |
| DXE64_RS13045 | - | 2557598..2558821 (-) | 1224 | WP_000206618.1 | ArgE/DapE family deacylase | - |
| DXE64_RS13050 | - | 2559253..2560308 (+) | 1056 | WP_000791397.1 | leukocidin family pore-forming toxin | - |
| DXE64_RS13055 | - | 2560330..2561346 (+) | 1017 | WP_000595612.1 | leukocidin/hemolysin toxin family protein | - |
| DXE64_RS13060 | sph | 2561608..2562432 (-) | 825 | Protein_2449 | sphingomyelin phosphodiesterase | - |
| DXE64_RS13065 | - | 2562489..2563526 (-) | 1038 | WP_000857191.1 | tyrosine-type recombinase/integrase | - |
| DXE64_RS13070 | - | 2563599..2564048 (-) | 450 | WP_231915586.1 | hypothetical protein | - |
| DXE64_RS13075 | - | 2564148..2564330 (-) | 183 | WP_000705248.1 | hypothetical protein | - |
| DXE64_RS13080 | - | 2564534..2564875 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| DXE64_RS13085 | - | 2564881..2565813 (-) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| DXE64_RS13090 | - | 2565829..2566542 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| DXE64_RS13095 | - | 2566505..2566678 (+) | 174 | WP_001801500.1 | hypothetical protein | - |
| DXE64_RS13100 | - | 2566675..2566956 (+) | 282 | WP_000854074.1 | helix-turn-helix transcriptional regulator | - |
| DXE64_RS13105 | - | 2566953..2567168 (+) | 216 | WP_001025404.1 | Thoeris anti-defense Tad2 family protein | - |
| DXE64_RS13110 | - | 2567157..2567486 (-) | 330 | WP_000128907.1 | hypothetical protein | - |
| DXE64_RS13115 | - | 2567537..2568289 (+) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| DXE64_RS13120 | - | 2568305..2568502 (+) | 198 | WP_001148862.1 | hypothetical protein | - |
| DXE64_RS13125 | - | 2568489..2568869 (-) | 381 | WP_000762519.1 | DUF2513 domain-containing protein | - |
| DXE64_RS13130 | - | 2568924..2569247 (+) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| DXE64_RS13135 | - | 2569244..2569405 (+) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| DXE64_RS13140 | - | 2569500..2569802 (+) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| DXE64_RS13145 | - | 2569807..2570067 (+) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| DXE64_RS13150 | - | 2570076..2570339 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| DXE64_RS13155 | - | 2570348..2572291 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| DXE64_RS13160 | - | 2572293..2573213 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| DXE64_RS13165 | - | 2573294..2573911 (+) | 618 | WP_114636105.1 | MBL fold metallo-hydrolase | - |
| DXE64_RS13170 | ssbA | 2573912..2574382 (+) | 471 | WP_000610648.1 | single-stranded DNA-binding protein | Machinery gene |
| DXE64_RS13175 | - | 2574412..2575305 (+) | 894 | WP_000148321.1 | DnaD domain protein | - |
| DXE64_RS13180 | - | 2575312..2575530 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| DXE64_RS13185 | - | 2575539..2575943 (+) | 405 | WP_114636106.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DXE64_RS13190 | - | 2575956..2576324 (+) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| DXE64_RS13195 | - | 2576328..2576570 (+) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| DXE64_RS13200 | - | 2576585..2576839 (+) | 255 | WP_001065097.1 | DUF1024 family protein | - |
| DXE64_RS14920 | - | 2576826..2576996 (+) | 171 | WP_000714403.1 | hypothetical protein | - |
| DXE64_RS13205 | - | 2576989..2577525 (+) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| DXE64_RS13210 | - | 2577562..2577807 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| DXE64_RS13215 | - | 2577804..2578010 (+) | 207 | WP_076686084.1 | DUF1381 domain-containing protein | - |
| DXE64_RS13220 | - | 2578007..2578393 (+) | 387 | WP_000592207.1 | hypothetical protein | - |
| DXE64_RS13225 | rinB | 2578390..2578539 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| DXE64_RS13230 | - | 2578539..2578739 (+) | 201 | WP_001622114.1 | DUF1514 family protein | - |
| DXE64_RS13235 | - | 2578767..2579183 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| DXE64_RS13240 | - | 2579415..2579714 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
| DXE64_RS13245 | - | 2579846..2580190 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| DXE64_RS13250 | - | 2580187..2581848 (+) | 1662 | WP_000625088.1 | terminase large subunit | - |
| DXE64_RS13255 | - | 2581864..2583051 (+) | 1188 | WP_000025274.1 | phage portal protein | - |
| DXE64_RS13260 | - | 2583035..2583772 (+) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| DXE64_RS13265 | - | 2583796..2584941 (+) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| DXE64_RS13270 | - | 2584961..2585245 (+) | 285 | WP_000238236.1 | hypothetical protein | - |
| DXE64_RS13275 | - | 2585235..2585519 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| DXE64_RS13280 | - | 2585503..2585865 (+) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| DXE64_RS13285 | - | 2585862..2586266 (+) | 405 | WP_114636107.1 | HK97 gp10 family phage protein | - |
| DXE64_RS13290 | - | 2586263..2586670 (+) | 408 | WP_000565498.1 | hypothetical protein | - |
| DXE64_RS13295 | - | 2586671..2587315 (+) | 645 | WP_000268733.1 | major tail protein | - |
| DXE64_RS13300 | - | 2587369..2587581 (+) | 213 | WP_078101489.1 | Ig-like domain-containing protein | - |
| DXE64_RS13305 | gpG | 2587631..2587981 (+) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| DXE64_RS14925 | gpGT | 2588032..2588169 (+) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| DXE64_RS13310 | - | 2588226..2592755 (+) | 4530 | WP_001796452.1 | phage tail tape measure protein | - |
| DXE64_RS13315 | - | 2592752..2594236 (+) | 1485 | WP_000567408.1 | phage distal tail protein | - |
| DXE64_RS13320 | - | 2594252..2598037 (+) | 3786 | WP_000582165.1 | phage tail spike protein | - |
| DXE64_RS13325 | - | 2598027..2598179 (+) | 153 | WP_001153681.1 | hypothetical protein | - |
| DXE64_RS13330 | - | 2598226..2598513 (+) | 288 | WP_001040261.1 | hypothetical protein | - |
| DXE64_RS13335 | - | 2598571..2598867 (+) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| DXE64_RS13340 | pepG1 | 2599059..2599193 (+) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| DXE64_RS13345 | - | 2599246..2599353 (-) | 108 | WP_001791821.1 | hypothetical protein | - |
| DXE64_RS13350 | - | 2599405..2599659 (+) | 255 | WP_000611512.1 | phage holin | - |
| DXE64_RS13355 | - | 2599671..2600426 (+) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DXE64_RS13360 | sak | 2600617..2601108 (+) | 492 | WP_000919350.1 | staphylokinase | - |
| DXE64_RS13370 | - | 2601755..2602093 (+) | 339 | Protein_2512 | SH3 domain-containing protein | - |
| DXE64_RS13375 | - | 2602188..2602637 (-) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| DXE64_RS13380 | scn | 2603322..2603672 (+) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=1149837 DXE64_RS13170 WP_000610648.1 2573912..2574382(+) (ssbA) [Staphylococcus aureus isolate 13_LA_301]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1149837 DXE64_RS13170 WP_000610648.1 2573912..2574382(+) (ssbA) [Staphylococcus aureus isolate 13_LA_301]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |