Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   DXE56_RS03015 Genome accession   NZ_LT992464
Coordinates   557218..557688 (+) Length   156 a.a.
NCBI ID   WP_000934770.1    Uniprot ID   -
Organism   Staphylococcus aureus isolate 3_LA_115     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 535602..586101 557218..557688 within 0


Gene organization within MGE regions


Location: 535602..586101
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DXE56_RS02860 groES 535602..535886 (+) 285 WP_000917289.1 co-chaperone GroES -
  DXE56_RS02865 groL 535962..537578 (+) 1617 WP_000240642.1 chaperonin GroEL -
  DXE56_RS02870 - 538119..538298 (+) 180 WP_000201398.1 hypothetical protein -
  DXE56_RS15035 - 538295..538921 (+) 627 WP_000216896.1 hypothetical protein -
  DXE56_RS02890 - 539460..540767 (-) 1308 WP_001045074.1 TrkH family potassium uptake protein -
  DXE56_RS02900 - 541150..542373 (-) 1224 WP_000206618.1 ArgE/DapE family deacylase -
  DXE56_RS02905 - 542805..543860 (+) 1056 WP_000791397.1 leukocidin family pore-forming toxin -
  DXE56_RS02910 - 543882..544898 (+) 1017 WP_000595612.1 leukocidin/hemolysin toxin family protein -
  DXE56_RS02915 sph 545160..545984 (-) 825 Protein_542 sphingomyelin phosphodiesterase -
  DXE56_RS02920 - 546041..547078 (-) 1038 WP_001814397.1 tyrosine-type recombinase/integrase -
  DXE56_RS02925 - 547271..547975 (-) 705 WP_000440838.1 type II toxin-antitoxin system PemK/MazF family toxin -
  DXE56_RS02930 - 548115..548282 (-) 168 WP_000705238.1 hypothetical protein -
  DXE56_RS02935 - 548438..549136 (-) 699 WP_000837517.1 potassium channel family protein -
  DXE56_RS02945 - 549318..549950 (-) 633 WP_031763806.1 LexA family transcriptional regulator -
  DXE56_RS02950 - 550104..550331 (+) 228 WP_000192116.1 helix-turn-helix transcriptional regulator -
  DXE56_RS02955 - 550354..551142 (+) 789 WP_031763800.1 phage antirepressor -
  DXE56_RS02960 - 551159..551356 (+) 198 WP_061651380.1 hypothetical protein -
  DXE56_RS02965 - 551387..551527 (+) 141 WP_000939496.1 hypothetical protein -
  DXE56_RS02970 - 551542..552174 (-) 633 WP_000275058.1 hypothetical protein -
  DXE56_RS02975 - 552233..552553 (+) 321 WP_001120197.1 DUF771 domain-containing protein -
  DXE56_RS02980 - 552550..552711 (+) 162 WP_000066017.1 DUF1270 domain-containing protein -
  DXE56_RS02985 - 552806..553132 (+) 327 WP_000165375.1 DUF2482 family protein -
  DXE56_RS02990 - 553113..553373 (+) 261 WP_000291503.1 DUF1108 family protein -
  DXE56_RS02995 - 553382..553645 (+) 264 WP_001205732.1 hypothetical protein -
  DXE56_RS03000 - 553654..555597 (+) 1944 WP_000700577.1 AAA family ATPase -
  DXE56_RS03005 - 555599..556519 (+) 921 WP_000138475.1 recombinase RecT -
  DXE56_RS03010 - 556600..557217 (+) 618 WP_071621397.1 MBL fold metallo-hydrolase -
  DXE56_RS03015 ssbA 557218..557688 (+) 471 WP_000934770.1 single-stranded DNA-binding protein Machinery gene
  DXE56_RS03020 - 557718..558602 (+) 885 WP_000148301.1 DnaD domain protein -
  DXE56_RS03025 - 558609..558827 (+) 219 WP_000338530.1 hypothetical protein -
  DXE56_RS03030 - 558836..559240 (+) 405 WP_000401960.1 RusA family crossover junction endodeoxyribonuclease -
  DXE56_RS03035 - 559253..559621 (+) 369 WP_114621361.1 SA1788 family PVL leukocidin-associated protein -
  DXE56_RS03040 - 559625..559780 (+) 156 Protein_566 SAV1978 family virulence-associated passenger protein -
  DXE56_RS03045 - 559788..560252 (+) 465 WP_078068207.1 dUTP diphosphatase -
  DXE56_RS03050 - 560289..560495 (+) 207 WP_000195803.1 DUF1381 domain-containing protein -
  DXE56_RS03055 - 560492..560878 (+) 387 WP_000592207.1 hypothetical protein -
  DXE56_RS03060 rinB 560875..561024 (+) 150 WP_000595265.1 transcriptional activator RinB -
  DXE56_RS03065 - 561024..561224 (+) 201 WP_000265043.1 DUF1514 family protein -
  DXE56_RS03070 - 561252..561668 (+) 417 WP_000590122.1 hypothetical protein -
  DXE56_RS03075 - 561900..562199 (+) 300 WP_000988330.1 HNH endonuclease -
  DXE56_RS03080 - 562329..562673 (+) 345 WP_000402904.1 hypothetical protein -
  DXE56_RS03085 - 562670..564331 (+) 1662 WP_000625096.1 terminase large subunit -
  DXE56_RS03090 - 564347..565534 (+) 1188 WP_000025266.1 phage portal protein -
  DXE56_RS03095 - 565518..566255 (+) 738 WP_000861912.1 head maturation protease, ClpP-related -
  DXE56_RS03100 - 566278..567423 (+) 1146 WP_031897300.1 phage major capsid protein -
  DXE56_RS03105 - 567443..567727 (+) 285 WP_000238236.1 hypothetical protein -
  DXE56_RS03110 - 567717..568001 (+) 285 WP_000150936.1 phage head-tail adapter protein -
  DXE56_RS03115 - 567985..568347 (+) 363 WP_000755150.1 head-tail adaptor protein -
  DXE56_RS03120 - 568344..568748 (+) 405 WP_000114341.1 HK97 gp10 family phage protein -
  DXE56_RS03125 - 568745..569152 (+) 408 WP_000565498.1 hypothetical protein -
  DXE56_RS03130 - 569153..569797 (+) 645 WP_000268736.1 major tail protein -
  DXE56_RS03135 - 569851..570063 (+) 213 WP_078101489.1 Ig-like domain-containing protein -
  DXE56_RS03140 gpG 570113..570463 (+) 351 WP_001096355.1 phage tail assembly chaperone G -
  DXE56_RS15040 gpGT 570514..570651 (+) 138 WP_001549167.1 phage tail assembly chaperone GT -
  DXE56_RS03145 - 570708..575237 (+) 4530 WP_062832901.1 phage tail tape measure protein -
  DXE56_RS03150 - 575234..576718 (+) 1485 WP_062832900.1 phage distal tail protein -
  DXE56_RS03155 - 576734..580519 (+) 3786 WP_062832899.1 phage tail spike protein -
  DXE56_RS03160 - 580509..580661 (+) 153 WP_001153681.1 hypothetical protein -
  DXE56_RS03165 - 580708..580995 (+) 288 WP_001040261.1 hypothetical protein -
  DXE56_RS03170 - 581053..581349 (+) 297 WP_000539688.1 DUF2951 domain-containing protein -
  DXE56_RS03175 pepG1 581541..581675 (+) 135 WP_000226108.1 type I toxin-antitoxin system toxin PepG1 -
  DXE56_RS03180 - 581728..581835 (-) 108 WP_001791821.1 hypothetical protein -
  DXE56_RS03185 - 581887..582141 (+) 255 WP_000611512.1 phage holin -
  DXE56_RS03190 - 582153..582908 (+) 756 WP_000861038.1 CHAP domain-containing protein -
  DXE56_RS03195 sak 583098..583589 (+) 492 WP_000920041.1 staphylokinase -
  DXE56_RS03210 - 584187..584524 (+) 338 Protein_599 SH3 domain-containing protein -
  DXE56_RS03215 - 584619..585068 (-) 450 WP_000727645.1 chemotaxis-inhibiting protein CHIPS -
  DXE56_RS03220 scn 585751..586101 (+) 351 WP_000702262.1 complement inhibitor SCIN-A -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17713.63 Da        Isoelectric Point: 5.2672

>NTDB_id=1149537 DXE56_RS03015 WP_000934770.1 557218..557688(+) (ssbA) [Staphylococcus aureus isolate 3_LA_115]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=1149537 DXE56_RS03015 WP_000934770.1 557218..557688(+) (ssbA) [Staphylococcus aureus isolate 3_LA_115]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment