Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | DXE29_RS14360 | Genome accession | NZ_LT992463 |
| Coordinates | 2799036..2799506 (+) | Length | 156 a.a. |
| NCBI ID | WP_114637998.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus isolate 2_LA_86 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2787718..2831145 | 2799036..2799506 | within | 0 |
Gene organization within MGE regions
Location: 2787718..2831145
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE29_RS14265 | - | 2787718..2788755 (-) | 1038 | WP_000857198.1 | tyrosine-type recombinase/integrase | - |
| DXE29_RS14270 | - | 2788928..2789467 (-) | 540 | WP_000391618.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DXE29_RS14275 | - | 2789607..2789774 (-) | 168 | WP_000705238.1 | hypothetical protein | - |
| DXE29_RS14280 | - | 2789845..2790030 (-) | 186 | WP_000109189.1 | hypothetical protein | - |
| DXE29_RS14800 | - | 2790027..2790173 (-) | 147 | WP_000345949.1 | hypothetical protein | - |
| DXE29_RS14285 | - | 2790247..2791101 (-) | 855 | WP_001557601.1 | HIRAN domain-containing protein | - |
| DXE29_RS14290 | - | 2791113..2791829 (-) | 717 | WP_001083975.1 | LexA family transcriptional regulator | - |
| DXE29_RS14295 | - | 2791993..2792235 (+) | 243 | WP_000639923.1 | DUF739 family protein | - |
| DXE29_RS14300 | - | 2792248..2792691 (+) | 444 | WP_001662741.1 | hypothetical protein | - |
| DXE29_RS14305 | - | 2792706..2792846 (+) | 141 | WP_000939495.1 | hypothetical protein | - |
| DXE29_RS14310 | - | 2792839..2793048 (-) | 210 | WP_000772137.1 | hypothetical protein | - |
| DXE29_RS14315 | - | 2793105..2793854 (+) | 750 | WP_001148337.1 | phage antirepressor KilAC domain-containing protein | - |
| DXE29_RS14320 | - | 2793867..2794127 (+) | 261 | WP_000435343.1 | hypothetical protein | - |
| DXE29_RS14965 | - | 2794151..2794306 (-) | 156 | Protein_2677 | hypothetical protein | - |
| DXE29_RS14325 | - | 2794360..2794680 (+) | 321 | WP_001120936.1 | DUF771 domain-containing protein | - |
| DXE29_RS14330 | - | 2794677..2794838 (+) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| DXE29_RS14335 | - | 2794931..2795191 (+) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| DXE29_RS14340 | - | 2795200..2795463 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| DXE29_RS14345 | - | 2795460..2797415 (+) | 1956 | WP_061741411.1 | AAA family ATPase | - |
| DXE29_RS14350 | - | 2797417..2798337 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| DXE29_RS14355 | - | 2798418..2799035 (+) | 618 | WP_072460574.1 | MBL fold metallo-hydrolase | - |
| DXE29_RS14360 | ssbA | 2799036..2799506 (+) | 471 | WP_114637998.1 | single-stranded DNA-binding protein | Machinery gene |
| DXE29_RS14365 | - | 2799536..2800420 (+) | 885 | WP_061741412.1 | DnaD domain protein | - |
| DXE29_RS14370 | - | 2800427..2800645 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| DXE29_RS14375 | - | 2800654..2801058 (+) | 405 | WP_000401964.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DXE29_RS14380 | - | 2801071..2801439 (+) | 369 | WP_000101270.1 | SA1788 family PVL leukocidin-associated protein | - |
| DXE29_RS14385 | - | 2801443..2801685 (+) | 243 | WP_000131381.1 | phi PVL orf 51-like protein | - |
| DXE29_RS14390 | - | 2801700..2801954 (+) | 255 | WP_114637999.1 | DUF1024 family protein | - |
| DXE29_RS14395 | - | 2801941..2802111 (+) | 171 | WP_000714407.1 | hypothetical protein | - |
| DXE29_RS14400 | - | 2802104..2802640 (+) | 537 | WP_031885699.1 | dUTPase | - |
| DXE29_RS14405 | - | 2802677..2802919 (+) | 243 | WP_000028780.1 | hypothetical protein | - |
| DXE29_RS14410 | - | 2802916..2803104 (+) | 189 | WP_000195782.1 | DUF1381 domain-containing protein | - |
| DXE29_RS14415 | - | 2803079..2803279 (+) | 201 | WP_001125015.1 | hypothetical protein | - |
| DXE29_RS14420 | rinB | 2803282..2803431 (+) | 150 | WP_000237868.1 | transcriptional activator RinB | - |
| DXE29_RS14425 | - | 2803431..2803631 (+) | 201 | WP_001557462.1 | DUF1514 family protein | - |
| DXE29_RS14430 | - | 2803659..2804075 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| DXE29_RS14435 | - | 2804307..2804606 (+) | 300 | WP_000988330.1 | HNH endonuclease | - |
| DXE29_RS14440 | - | 2804737..2805081 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| DXE29_RS14445 | - | 2805078..2806739 (+) | 1662 | WP_000625087.1 | terminase large subunit | - |
| DXE29_RS14450 | - | 2806755..2807942 (+) | 1188 | WP_000025266.1 | phage portal protein | - |
| DXE29_RS14455 | - | 2807926..2808663 (+) | 738 | WP_031897301.1 | head maturation protease, ClpP-related | - |
| DXE29_RS14460 | - | 2808686..2809831 (+) | 1146 | WP_000154567.1 | phage major capsid protein | - |
| DXE29_RS14465 | - | 2809851..2810135 (+) | 285 | WP_000238240.1 | hypothetical protein | - |
| DXE29_RS14470 | - | 2810125..2810409 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| DXE29_RS14475 | - | 2810393..2810755 (+) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| DXE29_RS14480 | - | 2810752..2811156 (+) | 405 | WP_000114341.1 | HK97 gp10 family phage protein | - |
| DXE29_RS14485 | - | 2811153..2811560 (+) | 408 | WP_000565498.1 | hypothetical protein | - |
| DXE29_RS14490 | - | 2811561..2812205 (+) | 645 | WP_000268736.1 | major tail protein | - |
| DXE29_RS14495 | - | 2812259..2812471 (+) | 213 | WP_078101489.1 | Ig-like domain-containing protein | - |
| DXE29_RS14500 | gpG | 2812521..2812871 (+) | 351 | WP_031906184.1 | phage tail assembly chaperone G | - |
| DXE29_RS14805 | gpGT | 2812922..2813059 (+) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| DXE29_RS14505 | - | 2813116..2817645 (+) | 4530 | WP_114638000.1 | phage tail tape measure protein | - |
| DXE29_RS14510 | - | 2817642..2819126 (+) | 1485 | WP_000567408.1 | phage distal tail protein | - |
| DXE29_RS14515 | - | 2819142..2822927 (+) | 3786 | WP_000582165.1 | phage tail spike protein | - |
| DXE29_RS14520 | - | 2822917..2823069 (+) | 153 | WP_001153681.1 | hypothetical protein | - |
| DXE29_RS14525 | - | 2823116..2823403 (+) | 288 | WP_001040261.1 | hypothetical protein | - |
| DXE29_RS14530 | - | 2823461..2823757 (+) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| DXE29_RS14535 | pepG1 | 2823949..2824083 (+) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| DXE29_RS14540 | - | 2824136..2824243 (-) | 108 | WP_001791821.1 | hypothetical protein | - |
| DXE29_RS14545 | - | 2824295..2824549 (+) | 255 | WP_000611512.1 | phage holin | - |
| DXE29_RS14550 | - | 2824561..2825316 (+) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DXE29_RS14555 | sak | 2825507..2825998 (+) | 492 | WP_000919350.1 | staphylokinase | - |
| DXE29_RS14565 | - | 2826645..2826983 (+) | 339 | Protein_2726 | SH3 domain-containing protein | - |
| DXE29_RS14570 | - | 2827078..2827527 (-) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| DXE29_RS14575 | scn | 2828212..2828562 (+) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| DXE29_RS14580 | - | 2828615..2828875 (-) | 261 | WP_001791826.1 | hypothetical protein | - |
| DXE29_RS15030 | - | 2828854..2829162 (-) | 309 | WP_001795394.1 | hypothetical protein | - |
| DXE29_RS14590 | - | 2829186..2829365 (-) | 180 | WP_000669789.1 | hypothetical protein | - |
| DXE29_RS14595 | - | 2829723..2830028 (-) | 306 | Protein_2732 | thiamine pyrophosphate-binding protein | - |
| DXE29_RS14600 | - | 2830068..2830757 (-) | 690 | WP_001001016.1 | LrgB family protein | - |
| DXE29_RS14605 | cidA | 2830750..2831145 (-) | 396 | WP_000549735.1 | holin-like murein hydrolase modulator CidA | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17741.68 Da Isoelectric Point: 5.2672
>NTDB_id=1149532 DXE29_RS14360 WP_114637998.1 2799036..2799506(+) (ssbA) [Staphylococcus aureus isolate 2_LA_86]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREVDFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREVDFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1149532 DXE29_RS14360 WP_114637998.1 2799036..2799506(+) (ssbA) [Staphylococcus aureus isolate 2_LA_86]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGTAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGTAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.802 |
100 |
0.622 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.545 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
67.949 |
0.397 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |