Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | DYY96_RS05290 | Genome accession | NZ_LT992435 |
| Coordinates | 1015711..1016181 (-) | Length | 156 a.a. |
| NCBI ID | WP_115657069.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus isolate 1549-SCV | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 986422..1036704 | 1015711..1016181 | within | 0 |
Gene organization within MGE regions
Location: 986422..1036704
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DYY96_RS05080 | scn | 986422..986772 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| DYY96_RS05085 | - | 987457..987906 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| DYY96_RS05090 | - | 988001..988339 (-) | 339 | Protein_940 | SH3 domain-containing protein | - |
| DYY96_RS05100 | sak | 988986..989477 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| DYY96_RS05105 | - | 989668..990423 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DYY96_RS05110 | - | 990435..990689 (-) | 255 | WP_000611512.1 | phage holin | - |
| DYY96_RS05115 | - | 990741..990848 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| DYY96_RS05120 | pepG1 | 990901..991035 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| DYY96_RS05125 | - | 991227..991523 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| DYY96_RS05130 | - | 991581..991868 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| DYY96_RS05135 | - | 991915..992067 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| DYY96_RS05140 | - | 992057..995842 (-) | 3786 | WP_000582165.1 | phage tail spike protein | - |
| DYY96_RS05145 | - | 995858..997342 (-) | 1485 | WP_000567408.1 | phage distal tail protein | - |
| DYY96_RS05150 | - | 997339..1001868 (-) | 4530 | WP_001796452.1 | phage tail tape measure protein | - |
| DYY96_RS14035 | gpGT | 1001925..1002062 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| DYY96_RS05155 | gpG | 1002113..1002463 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| DYY96_RS05160 | - | 1002513..1002737 (-) | 225 | WP_071621395.1 | Ig-like domain-containing protein | - |
| DYY96_RS05165 | - | 1002779..1003423 (-) | 645 | WP_000268733.1 | major tail protein | - |
| DYY96_RS05170 | - | 1003424..1003831 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| DYY96_RS05175 | - | 1003828..1004232 (-) | 405 | WP_000114227.1 | HK97 gp10 family phage protein | - |
| DYY96_RS05180 | - | 1004229..1004591 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| DYY96_RS05185 | - | 1004575..1004859 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| DYY96_RS05190 | - | 1004849..1005133 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| DYY96_RS05195 | - | 1005153..1006298 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| DYY96_RS05200 | - | 1006322..1007059 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| DYY96_RS05205 | - | 1007043..1008230 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| DYY96_RS05210 | - | 1008246..1009907 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| DYY96_RS05215 | - | 1009904..1010248 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| DYY96_RS05220 | - | 1010379..1010678 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| DYY96_RS05225 | - | 1010910..1011326 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| DYY96_RS05230 | - | 1011354..1011554 (-) | 201 | WP_001622114.1 | DUF1514 family protein | - |
| DYY96_RS05235 | rinB | 1011554..1011703 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| DYY96_RS05240 | - | 1011700..1012086 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| DYY96_RS05245 | - | 1012083..1012289 (-) | 207 | WP_076686084.1 | DUF1381 domain-containing protein | - |
| DYY96_RS05250 | - | 1012286..1012531 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| DYY96_RS05255 | - | 1012568..1013104 (-) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| DYY96_RS14040 | - | 1013097..1013267 (-) | 171 | WP_000714403.1 | hypothetical protein | - |
| DYY96_RS05260 | - | 1013254..1013508 (-) | 255 | WP_001065097.1 | DUF1024 family protein | - |
| DYY96_RS05265 | - | 1013523..1013765 (-) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| DYY96_RS05270 | - | 1013769..1014137 (-) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| DYY96_RS05275 | - | 1014150..1014554 (-) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DYY96_RS05280 | - | 1014563..1014781 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| DYY96_RS05285 | - | 1014788..1015681 (-) | 894 | WP_115657068.1 | DnaD domain protein | - |
| DYY96_RS05290 | ssbA | 1015711..1016181 (-) | 471 | WP_115657069.1 | single-stranded DNA-binding protein | Machinery gene |
| DYY96_RS05295 | - | 1016182..1016799 (-) | 618 | WP_073394849.1 | MBL fold metallo-hydrolase | - |
| DYY96_RS05300 | - | 1016880..1017800 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| DYY96_RS05305 | - | 1017802..1019745 (-) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| DYY96_RS05310 | - | 1019754..1020017 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| DYY96_RS05315 | - | 1020026..1020286 (-) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| DYY96_RS05320 | - | 1020291..1020593 (-) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| DYY96_RS05325 | - | 1020688..1020849 (-) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| DYY96_RS05330 | - | 1020846..1021169 (-) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| DYY96_RS05335 | - | 1021224..1021604 (+) | 381 | WP_000762519.1 | DUF2513 domain-containing protein | - |
| DYY96_RS05340 | - | 1021591..1021788 (-) | 198 | WP_001148862.1 | hypothetical protein | - |
| DYY96_RS05345 | - | 1021804..1022556 (-) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| DYY96_RS05350 | - | 1022607..1022936 (+) | 330 | WP_000128907.1 | hypothetical protein | - |
| DYY96_RS05355 | - | 1022925..1023140 (-) | 216 | WP_001025404.1 | Thoeris anti-defense Tad2 family protein | - |
| DYY96_RS05360 | - | 1023137..1023418 (-) | 282 | WP_000854074.1 | helix-turn-helix transcriptional regulator | - |
| DYY96_RS05365 | - | 1023415..1023588 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| DYY96_RS05370 | - | 1023551..1024264 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| DYY96_RS05375 | - | 1024280..1025212 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| DYY96_RS05380 | - | 1025218..1025559 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| DYY96_RS05385 | - | 1025763..1025945 (+) | 183 | WP_000705248.1 | hypothetical protein | - |
| DYY96_RS05390 | - | 1026045..1026509 (+) | 465 | WP_000825947.1 | hypothetical protein | - |
| DYY96_RS05395 | - | 1026568..1027605 (+) | 1038 | WP_000857191.1 | tyrosine-type recombinase/integrase | - |
| DYY96_RS05400 | sph | 1027662..1028486 (+) | 825 | Protein_1003 | sphingomyelin phosphodiesterase | - |
| DYY96_RS05405 | - | 1028743..1029762 (-) | 1020 | WP_000595616.1 | leukocidin/hemolysin toxin family protein | - |
| DYY96_RS05410 | - | 1029784..1030839 (-) | 1056 | WP_000791399.1 | leukocidin family pore-forming toxin | - |
| DYY96_RS05415 | - | 1031270..1032493 (+) | 1224 | WP_000206615.1 | ArgE/DapE family deacylase | - |
| DYY96_RS05420 | - | 1032889..1034196 (+) | 1308 | WP_115657070.1 | TrkH family potassium uptake protein | - |
| DYY96_RS05425 | groL | 1034728..1036344 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| DYY96_RS05430 | groES | 1036420..1036704 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17640.58 Da Isoelectric Point: 8.3589
>NTDB_id=1149209 DYY96_RS05290 WP_115657069.1 1015711..1016181(-) (ssbA) [Staphylococcus aureus isolate 1549-SCV]
MINRTILVGRLTRDPKLRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MINRTILVGRLTRDPKLRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1149209 DYY96_RS05290 WP_115657069.1 1015711..1016181(-) (ssbA) [Staphylococcus aureus isolate 1549-SCV]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAAAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAAAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.802 |
100 |
0.622 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |