Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | DYY92_RS05290 | Genome accession | NZ_LT992434 |
| Coordinates | 1015705..1016175 (-) | Length | 156 a.a. |
| NCBI ID | WP_115657069.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus isolate 1549-WT | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 986416..1036698 | 1015705..1016175 | within | 0 |
Gene organization within MGE regions
Location: 986416..1036698
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DYY92_RS05080 | scn | 986416..986766 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| DYY92_RS05085 | - | 987451..987900 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| DYY92_RS05090 | - | 987995..988333 (-) | 339 | Protein_940 | SH3 domain-containing protein | - |
| DYY92_RS05100 | sak | 988980..989471 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| DYY92_RS05105 | - | 989662..990417 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DYY92_RS05110 | - | 990429..990683 (-) | 255 | WP_000611512.1 | phage holin | - |
| DYY92_RS05115 | - | 990735..990842 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| DYY92_RS05120 | pepG1 | 990895..991029 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| DYY92_RS05125 | - | 991221..991517 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| DYY92_RS05130 | - | 991575..991862 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| DYY92_RS05135 | - | 991909..992061 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| DYY92_RS05140 | - | 992051..995836 (-) | 3786 | WP_000582165.1 | phage tail spike protein | - |
| DYY92_RS05145 | - | 995852..997336 (-) | 1485 | WP_000567408.1 | phage distal tail protein | - |
| DYY92_RS05150 | - | 997333..1001862 (-) | 4530 | WP_001796452.1 | phage tail tape measure protein | - |
| DYY92_RS14040 | gpGT | 1001919..1002056 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| DYY92_RS05155 | gpG | 1002107..1002457 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| DYY92_RS05160 | - | 1002507..1002731 (-) | 225 | WP_071621395.1 | Ig-like domain-containing protein | - |
| DYY92_RS05165 | - | 1002773..1003417 (-) | 645 | WP_000268733.1 | major tail protein | - |
| DYY92_RS05170 | - | 1003418..1003825 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| DYY92_RS05175 | - | 1003822..1004226 (-) | 405 | WP_000114227.1 | HK97 gp10 family phage protein | - |
| DYY92_RS05180 | - | 1004223..1004585 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| DYY92_RS05185 | - | 1004569..1004853 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| DYY92_RS05190 | - | 1004843..1005127 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| DYY92_RS05195 | - | 1005147..1006292 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| DYY92_RS05200 | - | 1006316..1007053 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| DYY92_RS05205 | - | 1007037..1008224 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| DYY92_RS05210 | - | 1008240..1009901 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| DYY92_RS05215 | - | 1009898..1010242 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| DYY92_RS05220 | - | 1010373..1010672 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| DYY92_RS05225 | - | 1010904..1011320 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| DYY92_RS05230 | - | 1011348..1011548 (-) | 201 | WP_001622114.1 | DUF1514 family protein | - |
| DYY92_RS05235 | rinB | 1011548..1011697 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| DYY92_RS05240 | - | 1011694..1012080 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| DYY92_RS05245 | - | 1012077..1012283 (-) | 207 | WP_076686084.1 | DUF1381 domain-containing protein | - |
| DYY92_RS05250 | - | 1012280..1012525 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| DYY92_RS05255 | - | 1012562..1013098 (-) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| DYY92_RS14045 | - | 1013091..1013261 (-) | 171 | WP_000714403.1 | hypothetical protein | - |
| DYY92_RS05260 | - | 1013248..1013502 (-) | 255 | WP_001065097.1 | DUF1024 family protein | - |
| DYY92_RS05265 | - | 1013517..1013759 (-) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| DYY92_RS05270 | - | 1013763..1014131 (-) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| DYY92_RS05275 | - | 1014144..1014548 (-) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DYY92_RS05280 | - | 1014557..1014775 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| DYY92_RS05285 | - | 1014782..1015675 (-) | 894 | WP_115657068.1 | DnaD domain protein | - |
| DYY92_RS05290 | ssbA | 1015705..1016175 (-) | 471 | WP_115657069.1 | single-stranded DNA-binding protein | Machinery gene |
| DYY92_RS05295 | - | 1016176..1016793 (-) | 618 | WP_073394849.1 | MBL fold metallo-hydrolase | - |
| DYY92_RS05300 | - | 1016874..1017794 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| DYY92_RS05305 | - | 1017796..1019739 (-) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| DYY92_RS05310 | - | 1019748..1020011 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| DYY92_RS05315 | - | 1020020..1020280 (-) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| DYY92_RS05320 | - | 1020285..1020587 (-) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| DYY92_RS05325 | - | 1020682..1020843 (-) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| DYY92_RS05330 | - | 1020840..1021163 (-) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| DYY92_RS05335 | - | 1021218..1021598 (+) | 381 | WP_000762519.1 | DUF2513 domain-containing protein | - |
| DYY92_RS05340 | - | 1021585..1021782 (-) | 198 | WP_001148862.1 | hypothetical protein | - |
| DYY92_RS05345 | - | 1021798..1022550 (-) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| DYY92_RS05350 | - | 1022601..1022930 (+) | 330 | WP_000128907.1 | hypothetical protein | - |
| DYY92_RS05355 | - | 1022919..1023134 (-) | 216 | WP_001025404.1 | Thoeris anti-defense Tad2 family protein | - |
| DYY92_RS05360 | - | 1023131..1023412 (-) | 282 | WP_000854074.1 | helix-turn-helix transcriptional regulator | - |
| DYY92_RS05365 | - | 1023409..1023582 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| DYY92_RS05370 | - | 1023545..1024258 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| DYY92_RS05375 | - | 1024274..1025206 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| DYY92_RS05380 | - | 1025212..1025553 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| DYY92_RS05385 | - | 1025757..1025939 (+) | 183 | WP_000705248.1 | hypothetical protein | - |
| DYY92_RS05390 | - | 1026039..1026503 (+) | 465 | WP_000825947.1 | hypothetical protein | - |
| DYY92_RS05395 | - | 1026562..1027599 (+) | 1038 | WP_000857191.1 | tyrosine-type recombinase/integrase | - |
| DYY92_RS05400 | sph | 1027656..1028480 (+) | 825 | Protein_1003 | sphingomyelin phosphodiesterase | - |
| DYY92_RS05405 | - | 1028737..1029756 (-) | 1020 | WP_000595616.1 | leukocidin/hemolysin toxin family protein | - |
| DYY92_RS05410 | - | 1029778..1030833 (-) | 1056 | WP_000791399.1 | leukocidin family pore-forming toxin | - |
| DYY92_RS05415 | - | 1031264..1032487 (+) | 1224 | WP_000206615.1 | ArgE/DapE family deacylase | - |
| DYY92_RS05420 | - | 1032883..1034190 (+) | 1308 | WP_115657070.1 | TrkH family potassium uptake protein | - |
| DYY92_RS05425 | groL | 1034722..1036338 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| DYY92_RS05430 | groES | 1036414..1036698 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17640.58 Da Isoelectric Point: 8.3589
>NTDB_id=1149168 DYY92_RS05290 WP_115657069.1 1015705..1016175(-) (ssbA) [Staphylococcus aureus isolate 1549-WT]
MINRTILVGRLTRDPKLRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MINRTILVGRLTRDPKLRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1149168 DYY92_RS05290 WP_115657069.1 1015705..1016175(-) (ssbA) [Staphylococcus aureus isolate 1549-WT]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAAAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAAAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.802 |
100 |
0.622 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |