Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ODI_RS06040 | Genome accession | NZ_LT907988 |
| Coordinates | 1322882..1323364 (-) | Length | 160 a.a. |
| NCBI ID | WP_067759387.1 | Uniprot ID | A0A1C3K831 |
| Organism | Orrella dioscoreae isolate Orrdi1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1315317..1356501 | 1322882..1323364 | within | 0 |
Gene organization within MGE regions
Location: 1315317..1356501
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ODI_RS22615 | - | 1315317..1315448 (-) | 132 | WP_269460526.1 | hypothetical protein | - |
| ODI_RS22220 | - | 1315518..1315874 (+) | 357 | WP_067757051.1 | hypothetical protein | - |
| ODI_RS05980 (ODI_01622) | - | 1315990..1316385 (+) | 396 | WP_067757054.1 | DUF1090 domain-containing protein | - |
| ODI_RS05985 (ODI_01623) | - | 1316415..1316969 (+) | 555 | WP_269460527.1 | PIN domain-containing protein | - |
| ODI_RS22225 | - | 1317081..1317230 (-) | 150 | WP_157929725.1 | hypothetical protein | - |
| ODI_RS22230 (ODI_01624) | - | 1317374..1317637 (-) | 264 | WP_074046833.1 | hypothetical protein | - |
| ODI_RS05990 (ODI_01625) | - | 1318159..1319193 (-) | 1035 | WP_231968207.1 | integrase | - |
| ODI_RS05995 (ODI_01626) | - | 1319190..1319396 (-) | 207 | WP_067757060.1 | DUF4224 domain-containing protein | - |
| ODI_RS06000 (ODI_01627) | - | 1319420..1319653 (-) | 234 | WP_067757062.1 | hypothetical protein | - |
| ODI_RS06005 | - | 1319656..1320051 (-) | 396 | WP_098020853.1 | hypothetical protein | - |
| ODI_RS06010 | - | 1320048..1320458 (-) | 411 | WP_098020854.1 | HNH endonuclease signature motif containing protein | - |
| ODI_RS06015 | - | 1320455..1320778 (-) | 324 | WP_098020855.1 | hypothetical protein | - |
| ODI_RS06020 | - | 1320768..1321853 (-) | 1086 | WP_098020856.1 | hypothetical protein | - |
| ODI_RS06025 (ODI_02472) | - | 1322021..1322242 (+) | 222 | WP_067759396.1 | hypothetical protein | - |
| ODI_RS06030 (ODI_02471) | - | 1322252..1322623 (-) | 372 | WP_067759393.1 | hypothetical protein | - |
| ODI_RS06040 (ODI_02470) | ssb | 1322882..1323364 (-) | 483 | WP_067759387.1 | single-stranded DNA-binding protein | Machinery gene |
| ODI_RS06045 (ODI_02469) | - | 1323367..1324317 (-) | 951 | WP_067759384.1 | ParB N-terminal domain-containing protein | - |
| ODI_RS06050 (ODI_02468) | - | 1324314..1324553 (-) | 240 | WP_067759381.1 | hypothetical protein | - |
| ODI_RS06055 (ODI_02467) | - | 1324550..1324759 (-) | 210 | WP_157929726.1 | hypothetical protein | - |
| ODI_RS06065 (ODI_02466) | - | 1326110..1326292 (-) | 183 | WP_067759375.1 | hypothetical protein | - |
| ODI_RS06070 (ODI_02465) | - | 1326347..1326586 (-) | 240 | WP_067759372.1 | hypothetical protein | - |
| ODI_RS06075 | - | 1327189..1327893 (+) | 705 | WP_269460528.1 | type VI secretion system-associated protein TagO | - |
| ODI_RS06080 | - | 1327904..1328215 (+) | 312 | WP_067759370.1 | hypothetical protein | - |
| ODI_RS06085 | - | 1328575..1329144 (+) | 570 | WP_067759367.1 | Panacea domain-containing protein | - |
| ODI_RS22240 | - | 1329144..1329554 (+) | 411 | WP_157929729.1 | hypothetical protein | - |
| ODI_RS06090 (ODI_02464) | - | 1329556..1330614 (-) | 1059 | WP_067759365.1 | S24 family peptidase | - |
| ODI_RS06095 | - | 1330684..1330908 (+) | 225 | WP_067759362.1 | Cro/CI family transcriptional regulator | - |
| ODI_RS06100 (ODI_02463) | - | 1330965..1331153 (-) | 189 | WP_157929730.1 | hypothetical protein | - |
| ODI_RS06105 (ODI_02462) | - | 1331269..1331790 (+) | 522 | WP_067759358.1 | hypothetical protein | - |
| ODI_RS06110 (ODI_02461) | - | 1331787..1332305 (+) | 519 | WP_162292290.1 | hypothetical protein | - |
| ODI_RS06115 (ODI_02460) | - | 1332302..1332637 (+) | 336 | WP_067759353.1 | DUF4406 domain-containing protein | - |
| ODI_RS06120 | - | 1332634..1333482 (+) | 849 | WP_098020858.1 | helix-turn-helix domain-containing protein | - |
| ODI_RS06125 (ODI_02458) | - | 1333457..1334188 (+) | 732 | WP_157929731.1 | hypothetical protein | - |
| ODI_RS06130 (ODI_02457) | - | 1334194..1334526 (+) | 333 | WP_231968208.1 | DUF1064 domain-containing protein | - |
| ODI_RS06135 (ODI_02456) | - | 1334529..1334894 (+) | 366 | WP_067759343.1 | hypothetical protein | - |
| ODI_RS06140 | - | 1334891..1335160 (+) | 270 | WP_067759341.1 | hypothetical protein | - |
| ODI_RS06150 | - | 1335322..1335636 (+) | 315 | WP_074046857.1 | HNH endonuclease | - |
| ODI_RS06155 | - | 1335915..1336331 (+) | 417 | WP_067759338.1 | P27 family phage terminase small subunit | - |
| ODI_RS06160 (ODI_02455) | - | 1336309..1338078 (+) | 1770 | WP_067759336.1 | terminase large subunit | - |
| ODI_RS06165 (ODI_02454) | - | 1338075..1339373 (+) | 1299 | WP_067759333.1 | phage portal protein | - |
| ODI_RS06170 (ODI_02453) | - | 1339385..1340254 (+) | 870 | WP_067759331.1 | head maturation protease, ClpP-related | - |
| ODI_RS06175 (ODI_02452) | - | 1340265..1341443 (+) | 1179 | WP_067759328.1 | phage major capsid protein | - |
| ODI_RS06180 | - | 1341494..1341715 (+) | 222 | WP_067759326.1 | hypothetical protein | - |
| ODI_RS06185 (ODI_02451) | - | 1341718..1342047 (+) | 330 | WP_067759324.1 | head-tail connector protein | - |
| ODI_RS06190 (ODI_02450) | - | 1342047..1342421 (+) | 375 | WP_067759438.1 | head-tail adaptor protein | - |
| ODI_RS06195 (ODI_02449) | - | 1342424..1342645 (+) | 222 | WP_067759322.1 | hypothetical protein | - |
| ODI_RS06200 (ODI_02448) | - | 1342642..1343127 (+) | 486 | WP_067759320.1 | hypothetical protein | - |
| ODI_RS06205 (ODI_02447) | - | 1343127..1343498 (+) | 372 | WP_067759318.1 | DUF3168 domain-containing protein | - |
| ODI_RS06210 (ODI_02446) | - | 1343509..1344054 (+) | 546 | WP_162292291.1 | phage tail tube protein | - |
| ODI_RS06215 (ODI_02445) | - | 1344064..1344396 (+) | 333 | WP_067759313.1 | hypothetical protein | - |
| ODI_RS06220 (ODI_02444) | - | 1344468..1344725 (+) | 258 | WP_067759311.1 | hypothetical protein | - |
| ODI_RS06225 (ODI_02443) | - | 1344735..1347776 (+) | 3042 | WP_067759309.1 | phage tail tape measure protein | - |
| ODI_RS06230 (ODI_02442) | - | 1347776..1348123 (+) | 348 | WP_067759306.1 | hypothetical protein | - |
| ODI_RS06235 (ODI_02441) | - | 1348125..1348601 (+) | 477 | WP_067759304.1 | DUF1833 family protein | - |
| ODI_RS06240 | - | 1348638..1349072 (+) | 435 | WP_067759302.1 | hypothetical protein | - |
| ODI_RS06250 (ODI_02439) | - | 1349499..1353362 (+) | 3864 | WP_082985507.1 | host specificity protein J | - |
| ODI_RS06255 | - | 1353365..1354030 (+) | 666 | WP_067759300.1 | hypothetical protein | - |
| ODI_RS06260 (ODI_02438) | - | 1354030..1354320 (+) | 291 | WP_067759297.1 | hypothetical protein | - |
| ODI_RS06265 (ODI_02437) | - | 1354317..1354715 (+) | 399 | WP_067759295.1 | DUF4376 domain-containing protein | - |
| ODI_RS06270 (ODI_02436) | - | 1354785..1355228 (+) | 444 | WP_067759293.1 | D-Ala-D-Ala carboxypeptidase family metallohydrolase | - |
| ODI_RS06275 (ODI_02435) | - | 1355236..1355565 (+) | 330 | WP_082985506.1 | hypothetical protein | - |
| ODI_RS06280 (ODI_02434) | - | 1355546..1356016 (+) | 471 | WP_067759291.1 | hypothetical protein | - |
| ODI_RS06285 (ODI_02433) | - | 1356028..1356501 (+) | 474 | WP_157929732.1 | DUF2514 family protein | - |
Sequence
Protein
Download Length: 160 a.a. Molecular weight: 17612.55 Da Isoelectric Point: 6.4829
>NTDB_id=1148220 ODI_RS06040 WP_067759387.1 1322882..1323364(-) (ssb) [Orrella dioscoreae isolate Orrdi1]
MASVNKVIIVGNLGRDPEVRYSPDGAAICTVSIATTSQWKDRNTGEKREDTEWHRVVFYNRLAEIAGEYLKKGRSVYIEG
RLKTRKWTDRQGVERYTTEIIADQMQMLGGREGGGQGGQRQATSAEDYQATREGRAAPPADNPANAGVGGVADLHDDIPF
MASVNKVIIVGNLGRDPEVRYSPDGAAICTVSIATTSQWKDRNTGEKREDTEWHRVVFYNRLAEIAGEYLKKGRSVYIEG
RLKTRKWTDRQGVERYTTEIIADQMQMLGGREGGGQGGQRQATSAEDYQATREGRAAPPADNPANAGVGGVADLHDDIPF
Nucleotide
Download Length: 483 bp
>NTDB_id=1148220 ODI_RS06040 WP_067759387.1 1322882..1323364(-) (ssb) [Orrella dioscoreae isolate Orrdi1]
ATGGCCAGCGTCAACAAGGTAATCATCGTCGGCAACCTCGGGCGAGATCCCGAGGTCCGCTACTCGCCCGATGGCGCAGC
CATCTGCACCGTGTCGATCGCCACCACCAGCCAGTGGAAAGACAGGAACACCGGTGAAAAGCGCGAGGACACGGAATGGC
ACCGCGTTGTGTTCTACAACCGGCTGGCCGAGATCGCTGGCGAGTATCTGAAGAAAGGCCGCTCGGTCTACATCGAGGGA
AGACTGAAGACCCGAAAATGGACGGATCGACAGGGGGTCGAGCGCTACACCACCGAAATCATCGCCGACCAGATGCAGAT
GCTGGGCGGGCGTGAGGGTGGCGGCCAAGGTGGGCAGCGCCAGGCCACTTCAGCCGAGGACTATCAGGCTACGCGCGAAG
GCCGCGCCGCGCCCCCGGCAGACAACCCCGCAAACGCTGGTGTCGGCGGGGTTGCTGATCTGCATGATGACATTCCGTTC
TAG
ATGGCCAGCGTCAACAAGGTAATCATCGTCGGCAACCTCGGGCGAGATCCCGAGGTCCGCTACTCGCCCGATGGCGCAGC
CATCTGCACCGTGTCGATCGCCACCACCAGCCAGTGGAAAGACAGGAACACCGGTGAAAAGCGCGAGGACACGGAATGGC
ACCGCGTTGTGTTCTACAACCGGCTGGCCGAGATCGCTGGCGAGTATCTGAAGAAAGGCCGCTCGGTCTACATCGAGGGA
AGACTGAAGACCCGAAAATGGACGGATCGACAGGGGGTCGAGCGCTACACCACCGAAATCATCGCCGACCAGATGCAGAT
GCTGGGCGGGCGTGAGGGTGGCGGCCAAGGTGGGCAGCGCCAGGCCACTTCAGCCGAGGACTATCAGGCTACGCGCGAAG
GCCGCGCCGCGCCCCCGGCAGACAACCCCGCAAACGCTGGTGTCGGCGGGGTTGCTGATCTGCATGATGACATTCCGTTC
TAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
48.913 |
100 |
0.562 |
| ssb | Vibrio cholerae strain A1552 |
46.995 |
100 |
0.538 |
| ssb | Neisseria meningitidis MC58 |
44.828 |
100 |
0.488 |
| ssb | Neisseria gonorrhoeae MS11 |
44.828 |
100 |
0.488 |