Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | NZAK3_RS10580 | Genome accession | NZ_LT009690 |
| Coordinates | 2082610..2083080 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934759.1 | Uniprot ID | A0A2I7Y8V1 |
| Organism | Staphylococcus aureus strain NZAK3 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2052292..2104420 | 2082610..2083080 | within | 0 |
Gene organization within MGE regions
Location: 2052292..2104420
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NZAK3_RS10380 | scn | 2052292..2052642 (-) | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| NZAK3_RS10385 | - | 2053325..2053774 (+) | 450 | WP_000727645.1 | chemotaxis-inhibiting protein CHIPS | - |
| NZAK3_RS10390 | - | 2053869..2054206 (-) | 338 | Protein_1968 | SH3 domain-containing protein | - |
| NZAK3_RS10395 | sak | 2054850..2055341 (-) | 492 | WP_000920042.1 | staphylokinase | - |
| NZAK3_RS10400 | - | 2055532..2056287 (-) | 756 | WP_000861026.1 | CHAP domain-containing protein | - |
| NZAK3_RS10405 | - | 2056299..2056553 (-) | 255 | WP_000611512.1 | phage holin | - |
| NZAK3_RS10410 | - | 2056605..2056712 (+) | 108 | WP_031762631.1 | hypothetical protein | - |
| NZAK3_RS14955 | pepG1 | 2056765..2056899 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| NZAK3_RS10415 | sep | 2057144..2057926 (-) | 783 | WP_000034846.1 | staphylococcal enterotoxin type P | - |
| NZAK3_RS10420 | - | 2058338..2058712 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| NZAK3_RS10425 | - | 2058768..2059055 (-) | 288 | WP_001262621.1 | hypothetical protein | - |
| NZAK3_RS10430 | - | 2059101..2059253 (-) | 153 | WP_001000058.1 | hypothetical protein | - |
| NZAK3_RS10435 | - | 2059246..2063028 (-) | 3783 | WP_000582152.1 | phage tail spike protein | - |
| NZAK3_RS10440 | - | 2063044..2064528 (-) | 1485 | WP_000567396.1 | phage distal tail protein | - |
| NZAK3_RS15615 | - | 2064525..2064722 (-) | 198 | WP_001810295.1 | hypothetical protein | - |
| NZAK3_RS10445 | - | 2064777..2069054 (-) | 4278 | WP_370695537.1 | phage tail tape measure protein | - |
| NZAK3_RS15575 | gpGT | 2069111..2069248 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| NZAK3_RS10450 | gpG | 2069299..2069649 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| NZAK3_RS14960 | - | 2069699..2069929 (-) | 231 | Protein_1984 | Ig-like domain-containing protein | - |
| NZAK3_RS10455 | - | 2069965..2070609 (-) | 645 | WP_000268740.1 | major tail protein | - |
| NZAK3_RS10460 | - | 2070610..2071017 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| NZAK3_RS10465 | - | 2071014..2071418 (-) | 405 | WP_000114226.1 | HK97 gp10 family phage protein | - |
| NZAK3_RS10470 | - | 2071415..2071777 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| NZAK3_RS10475 | - | 2071761..2072045 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| NZAK3_RS10480 | - | 2072035..2072319 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| NZAK3_RS10485 | - | 2072339..2073484 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| NZAK3_RS10490 | - | 2073508..2074245 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| NZAK3_RS10495 | - | 2074229..2075416 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| NZAK3_RS10500 | - | 2075432..2077093 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| NZAK3_RS10505 | - | 2077090..2077434 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| NZAK3_RS10510 | - | 2077564..2077863 (-) | 300 | WP_000988332.1 | HNH endonuclease | - |
| NZAK3_RS10515 | - | 2078095..2078511 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| NZAK3_RS10520 | - | 2078539..2078739 (-) | 201 | WP_001557462.1 | DUF1514 family protein | - |
| NZAK3_RS10525 | rinB | 2078739..2078888 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| NZAK3_RS10530 | - | 2078885..2079091 (-) | 207 | WP_000195784.1 | DUF1381 domain-containing protein | - |
| NZAK3_RS10535 | - | 2079088..2079333 (-) | 246 | WP_001282077.1 | hypothetical protein | - |
| NZAK3_RS10540 | - | 2079370..2079906 (-) | 537 | WP_000185693.1 | dUTPase | - |
| NZAK3_RS10545 | - | 2079903..2080148 (-) | 246 | WP_001065108.1 | DUF1024 family protein | - |
| NZAK3_RS10550 | - | 2080163..2080405 (-) | 243 | WP_000221877.1 | SAV1978 family virulence-associated passenger protein | - |
| NZAK3_RS10555 | - | 2080408..2080665 (-) | 258 | WP_000111491.1 | DUF3310 domain-containing protein | - |
| NZAK3_RS10560 | - | 2080665..2081036 (-) | 372 | WP_000101279.1 | SA1788 family PVL leukocidin-associated protein | - |
| NZAK3_RS10565 | - | 2081049..2081453 (-) | 405 | WP_000401969.1 | RusA family crossover junction endodeoxyribonuclease | - |
| NZAK3_RS10570 | - | 2081462..2081680 (-) | 219 | WP_000338528.1 | hypothetical protein | - |
| NZAK3_RS10575 | - | 2081687..2082580 (-) | 894 | WP_000148333.1 | DnaD domain protein | - |
| NZAK3_RS10580 | ssbA | 2082610..2083080 (-) | 471 | WP_000934759.1 | single-stranded DNA-binding protein | Machinery gene |
| NZAK3_RS10585 | - | 2083081..2083698 (-) | 618 | WP_064135358.1 | MBL fold metallo-hydrolase | - |
| NZAK3_RS10590 | - | 2083779..2084699 (-) | 921 | WP_000180600.1 | recombinase RecT | - |
| NZAK3_RS10595 | - | 2084701..2086644 (-) | 1944 | WP_000700554.1 | AAA family ATPase | - |
| NZAK3_RS14965 | - | 2086653..2086916 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| NZAK3_RS10600 | - | 2086925..2087185 (-) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| NZAK3_RS10605 | - | 2087190..2087492 (-) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| NZAK3_RS10610 | - | 2087587..2087748 (-) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| NZAK3_RS10615 | - | 2087745..2088068 (-) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| NZAK3_RS10620 | - | 2088123..2088503 (+) | 381 | WP_000762521.1 | DUF2513 domain-containing protein | - |
| NZAK3_RS10625 | - | 2088490..2088687 (-) | 198 | WP_001148856.1 | hypothetical protein | - |
| NZAK3_RS10630 | - | 2088703..2089455 (-) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| NZAK3_RS10635 | - | 2089506..2089835 (+) | 330 | WP_000128909.1 | hypothetical protein | - |
| NZAK3_RS10640 | - | 2089824..2090039 (-) | 216 | WP_001025404.1 | Thoeris anti-defense Tad2 family protein | - |
| NZAK3_RS10645 | - | 2090055..2090318 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| NZAK3_RS10650 | - | 2090315..2090489 (-) | 175 | Protein_2025 | transcriptional regulator | - |
| NZAK3_RS10655 | - | 2090452..2091165 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| NZAK3_RS10660 | - | 2091181..2092113 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| NZAK3_RS10665 | - | 2092119..2092460 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| NZAK3_RS10670 | - | 2092664..2092846 (+) | 183 | WP_000694772.1 | hypothetical protein | - |
| NZAK3_RS10675 | - | 2092946..2093929 (+) | 984 | WP_001558608.1 | glycosyltransferase family 2 protein | - |
| NZAK3_RS10680 | - | 2093940..2094182 (+) | 243 | WP_000427213.1 | hypothetical protein | - |
| NZAK3_RS10685 | - | 2094245..2095282 (+) | 1038 | WP_000857180.1 | tyrosine-type recombinase/integrase | - |
| NZAK3_RS10690 | sph | 2095339..2096163 (+) | 825 | Protein_2033 | sphingomyelin phosphodiesterase | - |
| NZAK3_RS10695 | lukG | 2096401..2097417 (-) | 1017 | WP_000595392.1 | bi-component leukocidin LukGH subunit G | - |
| NZAK3_RS10700 | lukH | 2097439..2098494 (-) | 1056 | WP_000791411.1 | bi-component leukocidin LukGH subunit H | - |
| NZAK3_RS10705 | - | 2098930..2100153 (+) | 1224 | WP_000206625.1 | ArgE/DapE family deacylase | - |
| NZAK3_RS10710 | - | 2100597..2101904 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| NZAK3_RS10715 | groL | 2102444..2104060 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| NZAK3_RS10720 | groES | 2104136..2104420 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=1143592 NZAK3_RS10580 WP_000934759.1 2082610..2083080(-) (ssbA) [Staphylococcus aureus strain NZAK3]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1143592 NZAK3_RS10580 WP_000934759.1 2082610..2083080(-) (ssbA) [Staphylococcus aureus strain NZAK3]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |