Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   CFU2785_RS13930 Genome accession   NZ_LS992183
Coordinates   2795015..2795476 (+) Length   153 a.a.
NCBI ID   WP_134215761.1    Uniprot ID   -
Organism   Citrobacter freundii isolate Citrobacter freundii str. U2785     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2756903..2800190 2795015..2795476 within 0


Gene organization within MGE regions


Location: 2756903..2800190
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CFU2785_RS26555 (CFU2785_02734) - 2756903..2759344 (-) 2442 WP_232051944.1 hypothetical protein -
  CFU2785_RS13640 (CFU2785_02735) - 2759403..2761880 (-) 2478 WP_134215675.1 host specificity factor TipJ family phage tail protein -
  CFU2785_RS13645 (CFU2785_02736) - 2761867..2762232 (-) 366 WP_134216477.1 NlpC/P60 family protein -
  CFU2785_RS13650 (CFU2785_02737) - 2762246..2762716 (-) 471 WP_134215677.1 hypothetical protein -
  CFU2785_RS13655 (CFU2785_02738) - 2762716..2763213 (-) 498 WP_134215679.1 hypothetical protein -
  CFU2785_RS13660 (CFU2785_02739) - 2763213..2766698 (-) 3486 WP_134215682.1 tape measure protein -
  CFU2785_RS13665 (CFU2785_02740) - 2766757..2767440 (-) 684 WP_134215684.1 DUF6246 family protein -
  CFU2785_RS13670 (CFU2785_02741) - 2767500..2768243 (-) 744 WP_134215686.1 Ig-like domain-containing protein -
  CFU2785_RS13675 (CFU2785_02742) - 2768306..2768689 (-) 384 WP_134215688.1 hypothetical protein -
  CFU2785_RS13680 (CFU2785_02743) - 2768686..2769054 (-) 369 WP_134215690.1 HK97 gp10 family phage protein -
  CFU2785_RS13685 (CFU2785_02744) - 2769057..2769407 (-) 351 WP_006808949.1 hypothetical protein -
  CFU2785_RS13690 (CFU2785_02745) - 2769400..2769795 (-) 396 WP_232051945.1 DUF6527 family protein -
  CFU2785_RS13700 (CFU2785_02747) - 2769902..2770282 (-) 381 WP_134215695.1 hypothetical protein -
  CFU2785_RS13705 (CFU2785_02748) - 2770359..2770646 (-) 288 WP_134215697.1 hypothetical protein -
  CFU2785_RS13710 (CFU2785_02749) - 2770686..2771717 (-) 1032 WP_134215698.1 major capsid protein -
  CFU2785_RS13715 (CFU2785_02750) - 2771729..2772163 (-) 435 WP_134215699.1 hypothetical protein -
  CFU2785_RS13720 (CFU2785_02751) - 2772163..2773548 (-) 1386 WP_134215701.1 DUF2213 domain-containing protein -
  CFU2785_RS13725 (CFU2785_02752) - 2773626..2773826 (+) 201 WP_134215703.1 hypothetical protein -
  CFU2785_RS13730 (CFU2785_02753) - 2773819..2774715 (-) 897 WP_232051990.1 phage minor head protein -
  CFU2785_RS13735 (CFU2785_02754) - 2774747..2776195 (-) 1449 WP_134215706.1 DUF1073 domain-containing protein -
  CFU2785_RS13740 (CFU2785_02755) - 2776207..2777679 (-) 1473 WP_134215707.1 DNA-packaging protein -
  CFU2785_RS13745 (CFU2785_02756) - 2777666..2778292 (-) 627 WP_134215709.1 terminase small subunit -
  CFU2785_RS13750 (CFU2785_02757) - 2778304..2778483 (-) 180 WP_134215711.1 hypothetical protein -
  CFU2785_RS13755 (CFU2785_02758) - 2778458..2778676 (-) 219 WP_134215713.1 hypothetical protein -
  CFU2785_RS13760 (CFU2785_02759) - 2778832..2779350 (-) 519 WP_134216478.1 Rha family transcriptional regulator -
  CFU2785_RS13765 (CFU2785_02760) - 2779557..2780018 (-) 462 WP_134215714.1 lysis protein -
  CFU2785_RS13770 (CFU2785_02761) - 2780015..2780491 (-) 477 WP_134215716.1 glycoside hydrolase family protein -
  CFU2785_RS13775 (CFU2785_02762) - 2780478..2780783 (-) 306 WP_026080593.1 phage holin family protein -
  CFU2785_RS13785 (CFU2785_02764) - 2781150..2781839 (-) 690 WP_134215718.1 bacteriophage antitermination protein Q -
  CFU2785_RS13790 (CFU2785_02765) - 2781836..2781952 (-) 117 WP_134215720.1 hypothetical protein -
  CFU2785_RS13795 (CFU2785_02766) - 2781949..2782332 (-) 384 WP_134215722.1 hypothetical protein -
  CFU2785_RS13800 (CFU2785_02767) rusA 2782329..2782691 (-) 363 WP_134215724.1 crossover junction endodeoxyribonuclease RusA -
  CFU2785_RS13805 (CFU2785_02768) - 2782688..2782978 (-) 291 WP_015964709.1 DUF1364 domain-containing protein -
  CFU2785_RS13810 - 2782971..2783141 (-) 171 WP_134215726.1 NinE family protein -
  CFU2785_RS13815 (CFU2785_02769) - 2783134..2783583 (-) 450 WP_134215728.1 recombination protein NinB -
  CFU2785_RS13825 (CFU2785_02771) - 2784097..2784789 (-) 693 WP_134215732.1 DUF551 domain-containing protein -
  CFU2785_RS13830 (CFU2785_02772) - 2784786..2785151 (-) 366 WP_134215735.1 HNH endonuclease -
  CFU2785_RS13835 (CFU2785_02773) - 2785153..2785479 (-) 327 WP_048224838.1 hypothetical protein -
  CFU2785_RS13840 (CFU2785_02774) - 2785481..2785915 (-) 435 WP_232051946.1 ead/Ea22-like family protein -
  CFU2785_RS13845 (CFU2785_02775) - 2785924..2786124 (-) 201 WP_134215739.1 hypothetical protein -
  CFU2785_RS26560 (CFU2785_02776) - 2786121..2786549 (-) 429 WP_232051947.1 hypothetical protein -
  CFU2785_RS13865 (CFU2785_02779) - 2787111..2787413 (-) 303 WP_134215744.1 hypothetical protein -
  CFU2785_RS13870 (CFU2785_02780) - 2787413..2788846 (-) 1434 WP_134215746.1 DnaB-like helicase C-terminal domain-containing protein -
  CFU2785_RS13875 (CFU2785_02781) - 2788836..2789732 (-) 897 WP_134215748.1 DNA replication protein -
  CFU2785_RS13880 (CFU2785_02782) - 2789725..2789868 (-) 144 WP_134215750.1 DUF2740 family protein -
  CFU2785_RS13885 (CFU2785_02783) - 2789894..2790193 (-) 300 WP_134215752.1 CII family transcriptional regulator -
  CFU2785_RS13890 (CFU2785_02784) - 2790333..2790563 (-) 231 WP_052928615.1 hypothetical protein -
  CFU2785_RS13895 (CFU2785_02785) - 2790643..2791350 (+) 708 WP_134216479.1 helix-turn-helix transcriptional regulator -
  CFU2785_RS13900 (CFU2785_02786) - 2791864..2792124 (+) 261 WP_110820164.1 hypothetical protein -
  CFU2785_RS13905 (CFU2785_02787) - 2792286..2792528 (+) 243 WP_134215754.1 hypothetical protein -
  CFU2785_RS26265 (CFU2785_02788) - 2792525..2792683 (+) 159 WP_172616062.1 hypothetical protein -
  CFU2785_RS13910 (CFU2785_02789) - 2792680..2792889 (+) 210 WP_134215756.1 cell division protein FtsZ -
  CFU2785_RS13915 (CFU2785_02790) - 2792961..2793932 (+) 972 WP_134215757.1 hypothetical protein -
  CFU2785_RS13920 (CFU2785_02791) - 2793940..2794137 (+) 198 WP_003833701.1 hypothetical protein -
  CFU2785_RS26270 (CFU2785_02792) - 2794134..2794292 (+) 159 WP_172616063.1 hypothetical protein -
  CFU2785_RS13925 (CFU2785_02793) - 2794289..2795014 (+) 726 WP_134215759.1 Rad52/Rad22 family DNA repair protein -
  CFU2785_RS13930 (CFU2785_02794) ssb 2795015..2795476 (+) 462 WP_134215761.1 single-stranded DNA-binding protein Machinery gene
  CFU2785_RS13935 (CFU2785_02795) - 2795485..2796033 (+) 549 WP_134215763.1 3'-5' exonuclease -
  CFU2785_RS13940 (CFU2785_02796) - 2796051..2796335 (+) 285 WP_134215765.1 hypothetical protein -
  CFU2785_RS13945 (CFU2785_02797) - 2796328..2796879 (+) 552 WP_134215767.1 phage N-6-adenine-methyltransferase -
  CFU2785_RS13950 (CFU2785_02798) - 2796876..2797094 (+) 219 WP_134215769.1 hypothetical protein -
  CFU2785_RS13955 - 2797189..2797371 (+) 183 WP_126956111.1 hypothetical protein -
  CFU2785_RS13960 (CFU2785_02799) - 2797368..2797589 (+) 222 WP_126956109.1 TraR/DksA family transcriptional regulator -
  CFU2785_RS13965 (CFU2785_02801) - 2797788..2798027 (+) 240 WP_126956107.1 DUF4222 domain-containing protein -
  CFU2785_RS13970 (CFU2785_02802) - 2798037..2798684 (+) 648 WP_134215771.1 hypothetical protein -
  CFU2785_RS13975 (CFU2785_02803) - 2798788..2799024 (+) 237 WP_134215773.1 helix-turn-helix domain-containing protein -
  CFU2785_RS13980 (CFU2785_02804) - 2798982..2800190 (-) 1209 WP_134215775.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 153 a.a.        Molecular weight: 16972.03 Da        Isoelectric Point: 5.7776

>NTDB_id=1143241 CFU2785_RS13930 WP_134215761.1 2795015..2795476(+) (ssb) [Citrobacter freundii isolate Citrobacter freundii str. U2785]
MASRGVNKVILVGNLGQDPEVRYLPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI
EGQLRTRKWTDQSGVDKYTTEVLVNVGGTMQMLGGKQAEGKPAGNSQQPQRIQQQPAQQHNEPPMDFDDDIPF

Nucleotide


Download         Length: 462 bp        

>NTDB_id=1143241 CFU2785_RS13930 WP_134215761.1 2795015..2795476(+) (ssb) [Citrobacter freundii isolate Citrobacter freundii str. U2785]
ATGGCAAGCAGAGGCGTAAACAAAGTGATCCTCGTCGGCAACCTCGGGCAAGACCCTGAGGTTCGCTATCTACCAAATGG
TGGCGCGGTAGCCAATATCACACTGGCAACTTCGGAATCATGGCGTGATAAAGCGACCGGTGAAATGAAAGAGCAGACCG
AATGGCACCGGGTGGTGCTGTTTGGCAAGTTGGCTGAAGTAGCCAGCGAATATCTTCGAAAAGGTTCTCAGGTGTACATC
GAAGGCCAGTTACGCACACGGAAATGGACAGACCAATCTGGTGTGGATAAGTACACCACTGAGGTGTTGGTTAACGTCGG
TGGAACCATGCAGATGCTTGGCGGGAAGCAAGCAGAAGGAAAACCAGCAGGTAACAGCCAGCAACCACAACGGATACAGC
AGCAACCGGCACAACAGCACAACGAGCCGCCTATGGATTTTGACGACGATATTCCATTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

67.978

100

0.791

  ssb Glaesserella parasuis strain SC1401

51.913

100

0.621

  ssb Neisseria meningitidis MC58

40.909

100

0.471

  ssb Neisseria gonorrhoeae MS11

40.909

100

0.471


Multiple sequence alignment