Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPOKI898_RS00200 Genome accession   NZ_CP006827
Coordinates   37148..37261 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori oki898     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32148..42261
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPOKI898_RS00175 (HPOKI898_00205) - 32205..34430 (+) 2226 WP_025276547.1 AAA family ATPase -
  HPOKI898_RS00180 (HPOKI898_00210) panD 34420..34770 (+) 351 WP_025276548.1 aspartate 1-decarboxylase -
  HPOKI898_RS00185 (HPOKI898_00215) - 34781..35074 (+) 294 WP_000347915.1 YbaB/EbfC family nucleoid-associated protein -
  HPOKI898_RS00190 (HPOKI898_00220) - 35074..36069 (+) 996 WP_025275450.1 PDZ domain-containing protein -
  HPOKI898_RS00195 (HPOKI898_00225) comB6 36077..37132 (+) 1056 WP_025276549.1 P-type conjugative transfer protein TrbL Machinery gene
  HPOKI898_RS00200 (HPOKI898_00230) comB7 37148..37261 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HPOKI898_RS00205 (HPOKI898_00235) comB8 37258..38001 (+) 744 WP_025275452.1 type IV secretion system protein Machinery gene
  HPOKI898_RS00210 (HPOKI898_00240) comB9 38001..38996 (+) 996 WP_025276550.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPOKI898_RS00215 (HPOKI898_00245) comB10 38989..40125 (+) 1137 WP_025276551.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPOKI898_RS00220 (HPOKI898_00250) - 40195..41613 (+) 1419 WP_025276552.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=114271 HPOKI898_RS00200 WP_001217873.1 37148..37261(+) (comB7) [Helicobacter pylori oki898]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=114271 HPOKI898_RS00200 WP_001217873.1 37148..37261(+) (comB7) [Helicobacter pylori oki898]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment