Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPOKI422_RS00200 Genome accession   NZ_CP006824
Coordinates   37144..37257 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori oki422     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32144..42257
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPOKI422_RS00175 (HPOKI422_00200) - 32201..34426 (+) 2226 WP_025366270.1 AAA family ATPase -
  HPOKI422_RS00180 (HPOKI422_00205) panD 34416..34766 (+) 351 WP_025276548.1 aspartate 1-decarboxylase -
  HPOKI422_RS00185 (HPOKI422_00210) - 34777..35070 (+) 294 WP_000347915.1 YbaB/EbfC family nucleoid-associated protein -
  HPOKI422_RS00190 (HPOKI422_00215) - 35070..36065 (+) 996 WP_025275450.1 PDZ domain-containing protein -
  HPOKI422_RS00195 (HPOKI422_00220) comB6 36073..37128 (+) 1056 WP_025366271.1 P-type conjugative transfer protein TrbL Machinery gene
  HPOKI422_RS00200 (HPOKI422_00225) comB7 37144..37257 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HPOKI422_RS00205 (HPOKI422_00230) comB8 37254..37997 (+) 744 WP_025275452.1 type IV secretion system protein Machinery gene
  HPOKI422_RS00210 (HPOKI422_00235) comB9 37997..38992 (+) 996 WP_025366272.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPOKI422_RS00215 (HPOKI422_00240) comB10 38985..40121 (+) 1137 WP_025276551.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPOKI422_RS00220 (HPOKI422_00245) - 40191..41609 (+) 1419 WP_025276552.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=114205 HPOKI422_RS00200 WP_001217873.1 37144..37257(+) (comB7) [Helicobacter pylori oki422]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=114205 HPOKI422_RS00200 WP_001217873.1 37144..37257(+) (comB7) [Helicobacter pylori oki422]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment