Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | DQL12_RS11665 | Genome accession | NZ_LS483450 |
| Coordinates | 2154404..2154529 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799686.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain 4041STDY6583227 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2149404..2159529
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL12_RS12615 | - | 2149764..2151367 (-) | 1604 | Protein_2142 | YhgE/Pip family protein | - |
| DQL12_RS11640 | - | 2151525..2152067 (+) | 543 | WP_050123485.1 | TetR/AcrR family transcriptional regulator | - |
| DQL12_RS11655 | comE | 2152309..2153061 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| DQL12_RS11660 | comD/comD2 | 2153058..2154383 (-) | 1326 | WP_000364845.1 | competence system sensor histidine kinase ComD | Regulator |
| DQL12_RS11665 | comC/comC2 | 2154404..2154529 (-) | 126 | WP_000799686.1 | competence-stimulating peptide ComC | Regulator |
| DQL12_RS11675 | rlmH | 2154811..2155290 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| DQL12_RS11680 | htrA | 2155473..2156654 (+) | 1182 | WP_000681598.1 | S1C family serine protease | Regulator |
| DQL12_RS11685 | spo0J | 2156712..2157470 (+) | 759 | WP_000410381.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4907.00 Da Isoelectric Point: 11.0006
>NTDB_id=1142026 DQL12_RS11665 WP_000799686.1 2154404..2154529(-) (comC/comC2) [Streptococcus pneumoniae strain 4041STDY6583227]
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=1142026 DQL12_RS11665 WP_000799686.1 2154404..2154529(-) (comC/comC2) [Streptococcus pneumoniae strain 4041STDY6583227]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae R6 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae G54 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae D39 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
57.5 |
97.561 |
0.561 |