Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   DQM92_RS01620 Genome accession   NZ_LS483350
Coordinates   352255..352758 (+) Length   167 a.a.
NCBI ID   WP_000934798.1    Uniprot ID   A0A0Z0SL74
Organism   Staphylococcus aureus strain NCTC11940     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 335950..423650 352255..352758 within 0


Gene organization within MGE regions


Location: 335950..423650
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DQM92_RS01540 (NCTC11940_00288) - 336506..337135 (+) 630 WP_000677714.1 ABC-2 transporter permease -
  DQM92_RS01545 (NCTC11940_00289) - 337502..338635 (-) 1134 WP_000245685.1 low temperature requirement protein A -
  DQM92_RS01550 (NCTC11940_00290) - 339174..340355 (+) 1182 WP_000199070.1 acetyl-CoA C-acetyltransferase -
  DQM92_RS01555 (NCTC11940_00291) - 340438..341190 (-) 753 WP_000195907.1 cyclase family protein -
  DQM92_RS01560 (NCTC11940_00292) metE 341233..343461 (-) 2229 WP_000207614.1 5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase -
  DQM92_RS01565 (NCTC11940_00293) - 343458..345299 (-) 1842 WP_000077318.1 bifunctional homocysteine S-methyltransferase/methylenetetrahydrofolate reductase -
  DQM92_RS01570 (NCTC11940_00294) metC 345268..346428 (-) 1161 WP_000175846.1 cystathionine beta-lyase MetC -
  DQM92_RS01575 (NCTC11940_00295) - 346425..347528 (-) 1104 WP_000655692.1 PLP-dependent transferase -
  DQM92_RS01585 (NCTC11940_00297) - 348192..349037 (+) 846 WP_001550052.1 ParB/RepB/Spo0J family partition protein -
  DQM92_RS01590 (NCTC11940_00298) - 349194..350075 (+) 882 WP_001077602.1 mechanosensitive ion channel family protein -
  DQM92_RS01595 (NCTC11940_00299) - 350105..350308 (+) 204 WP_000157345.1 DUF951 domain-containing protein -
  DQM92_RS01600 (NCTC11940_00300) ychF 350320..351417 (+) 1098 WP_001218732.1 redox-regulated ATPase YchF -
  DQM92_RS01605 (NCTC11940_00301) - 351503..351694 (-) 192 WP_001052483.1 hypothetical protein -
  DQM92_RS01615 (NCTC11940_00302) rpsF 351938..352234 (+) 297 WP_001261460.1 30S ribosomal protein S6 -
  DQM92_RS01620 (NCTC11940_00303) ssbA 352255..352758 (+) 504 WP_000934798.1 single-stranded DNA-binding protein Machinery gene
  DQM92_RS01625 (NCTC11940_00304) rpsR 352810..353052 (+) 243 WP_000897044.1 30S ribosomal protein S18 -
  DQM92_RS01630 (NCTC11940_00305) - 353318..354256 (-) 939 WP_001822249.1 Abi family protein -
  DQM92_RS14755 - 354295..354996 (-) 702 Protein_310 tyrosine-type recombinase/integrase -
  DQM92_RS01645 (NCTC11940_00307) selX 355202..355813 (+) 612 WP_000475326.1 staphylococcal enterotoxin-like toxin X -
  DQM92_RS01650 (NCTC11940_00308) - 356182..356550 (+) 369 WP_000849177.1 YxeA family protein -
  DQM92_RS01655 (NCTC11940_00309) - 356731..357303 (+) 573 WP_000769720.1 PepSY domain-containing protein -
  DQM92_RS01660 (NCTC11940_00310) - 357441..357704 (-) 264 WP_001055897.1 helix-turn-helix domain-containing protein -
  DQM92_RS01665 (NCTC11940_00311) - 358004..358255 (+) 252 WP_000466748.1 GlsB/YeaQ/YmgE family stress response membrane protein -
  DQM92_RS01670 - 358294..358503 (-) 210 WP_000211676.1 hypothetical protein -
  DQM92_RS01675 (NCTC11940_00312) - 358681..359262 (+) 582 WP_000158374.1 histidine phosphatase family protein -
  DQM92_RS01680 (NCTC11940_00313) - 359328..359711 (-) 384 WP_000868248.1 hypothetical protein -
  DQM92_RS01685 (NCTC11940_00314) - 359966..360592 (-) 627 WP_000746687.1 NDxxF motif lipoprotein -
  DQM92_RS01690 (NCTC11940_00315) - 360665..360901 (-) 237 Protein_320 hypothetical protein -
  DQM92_RS01695 (NCTC11940_00316) ahpF 361037..362560 (-) 1524 WP_000930486.1 alkyl hydroperoxide reductase subunit F -
  DQM92_RS01700 (NCTC11940_00317) ahpC 362576..363145 (-) 570 WP_000052781.1 alkyl hydroperoxide reductase subunit C -
  DQM92_RS01705 (NCTC11940_00318) nfsA 363637..364392 (+) 756 WP_001289311.1 oxygen-insensitive NADPH nitroreductase -
  DQM92_RS01710 (NCTC11940_00319) - 364473..365861 (-) 1389 WP_000991007.1 L-cystine transporter -
  DQM92_RS01715 - 365946..366047 (+) 102 WP_001789518.1 hypothetical protein -
  DQM92_RS01725 (NCTC11940_00320) - 366838..367794 (-) 957 WP_000956132.1 hypothetical protein -
  DQM92_RS01730 (NCTC11940_00321) - 367912..368574 (-) 663 WP_000394698.1 hypothetical protein -
  DQM92_RS01735 (NCTC11940_00322) - 368717..369124 (-) 408 WP_000763768.1 general stress protein -
  DQM92_RS01740 (NCTC11940_00324) xpt 369637..370215 (+) 579 WP_000421410.1 xanthine phosphoribosyltransferase -
  DQM92_RS01745 (NCTC11940_00325) pbuX 370215..371483 (+) 1269 WP_000793009.1 xanthine permease PbuX -
  DQM92_RS01750 (NCTC11940_00326) guaB 371521..372987 (+) 1467 WP_000264071.1 IMP dehydrogenase -
  DQM92_RS01755 (NCTC11940_00327) guaA 373012..374553 (+) 1542 WP_000424966.1 glutamine-hydrolyzing GMP synthase -
  DQM92_RS01760 (NCTC11940_00328) - 374621..375814 (-) 1194 WP_000237796.1 site-specific integrase -
  DQM92_RS01765 (NCTC11940_00329) - 375841..376041 (-) 201 WP_000633907.1 DUF3173 family protein -
  DQM92_RS01775 (NCTC11940_00330) - 376539..376769 (-) 231 WP_000845143.1 helix-turn-helix domain-containing protein -
  DQM92_RS01780 (NCTC11940_00331) - 376766..377188 (-) 423 WP_000804879.1 RNA polymerase sigma factor -
  DQM92_RS01790 (NCTC11940_00332) - 377719..378072 (+) 354 WP_001227350.1 helix-turn-helix domain-containing protein -
  DQM92_RS01795 - 378130..378315 (-) 186 WP_413926387.1 cysteine-rich KTR domain-containing protein -
  DQM92_RS01800 (NCTC11940_00333) tet(M) 378416..380335 (-) 1920 WP_000691737.1 tetracycline resistance ribosomal protection protein Tet(M) -
  DQM92_RS01805 - 380351..380467 (-) 117 WP_001791010.1 tetracycline resistance determinant leader peptide -
  DQM92_RS01815 (NCTC11940_00334) - 380712..381641 (-) 930 WP_000584387.1 conjugal transfer protein -
  DQM92_RS01820 (NCTC11940_00335) - 381658..382680 (-) 1023 WP_000768373.1 bifunctional lytic transglycosylase/C40 family peptidase -
  DQM92_RS01825 (NCTC11940_00336) - 382677..384704 (-) 2028 WP_000192392.1 CD3337/EF1877 family mobilome membrane protein -
  DQM92_RS01830 (NCTC11940_00337) - 384701..387154 (-) 2454 WP_000331168.1 ATP-binding protein -
  DQM92_RS01835 (NCTC11940_00338) - 387138..387533 (-) 396 WP_000723887.1 conjugal transfer protein -
  DQM92_RS01840 (NCTC11940_00339) - 387605..388234 (-) 630 WP_000273483.1 DUF6037 family protein -
  DQM92_RS01845 (NCTC11940_00340) istB 388263..388991 (-) 729 WP_001071399.1 IS21-like element helper ATPase IstB -
  DQM92_RS01850 (NCTC11940_00341) istA 388991..390418 (-) 1428 WP_000957075.1 IS21 family transposase -
  DQM92_RS14915 (NCTC11940_00342) - 390502..390630 (-) 129 WP_000248478.1 hypothetical protein -
  DQM92_RS01855 (NCTC11940_00343) - 390686..391186 (-) 501 WP_000425404.1 antirestriction protein ArdA -
  DQM92_RS01860 (NCTC11940_00344) - 391247..392026 (-) 780 WP_000675717.1 abortive infection family protein -
  DQM92_RS01865 (NCTC11940_00345) - 392068..392289 (-) 222 WP_001009054.1 hypothetical protein -
  DQM92_RS01870 (NCTC11940_00346) - 392286..392576 (-) 291 WP_000055376.1 hypothetical protein -
  DQM92_RS01875 (NCTC11940_00347) mobT 392573..393757 (-) 1185 WP_000426690.1 MobT family relaxase -
  DQM92_RS01880 (NCTC11940_00348) - 393939..395342 (-) 1404 WP_001130246.1 FtsK/SpoIIIE domain-containing protein -
  DQM92_RS01885 (NCTC11940_00349) - 395364..396137 (-) 774 WP_000185761.1 hypothetical protein -
  DQM92_RS01890 (NCTC11940_00350) - 396147..396524 (-) 378 WP_001234191.1 YdcP family protein -
  DQM92_RS01895 (NCTC11940_00351) - 396545..396859 (-) 315 WP_000421279.1 YdcP family protein -
  DQM92_RS01900 (NCTC11940_00352) - 397059..398852 (-) 1794 WP_000181735.1 ATP-dependent helicase -
  DQM92_RS01905 (NCTC11940_00353) - 398849..401038 (-) 2190 WP_000470931.1 ATP-dependent nuclease -
  DQM92_RS01910 (NCTC11940_00354) - 401172..402369 (-) 1198 Protein_361 IS256-like element ISLgar5 family transposase -
  DQM92_RS01920 (NCTC11940_00356) - 402863..403399 (-) 537 WP_000551776.1 hypothetical protein -
  DQM92_RS01925 (NCTC11940_00357) - 403792..404496 (-) 705 WP_000041883.1 type II toxin-antitoxin system PemK/MazF family toxin -
  DQM92_RS01930 (NCTC11940_00358) - 404895..405167 (-) 273 WP_000159787.1 transposase -
  DQM92_RS01940 (NCTC11940_00359) - 405428..405580 (-) 153 WP_000248839.1 hypothetical protein -
  DQM92_RS01945 (NCTC11940_00360) - 406104..406463 (-) 360 WP_001021622.1 DUF1304 domain-containing protein -
  DQM92_RS01950 (NCTC11940_00361) - 406482..407327 (-) 846 WP_001024377.1 SDR family oxidoreductase -
  DQM92_RS01955 (NCTC11940_00362) - 407799..408479 (+) 681 WP_000669005.1 superantigen-like protein SSL1 -
  DQM92_RS01960 (NCTC11940_00363) - 408765..409460 (+) 696 WP_000782618.1 superantigen-like protein SSL2 -
  DQM92_RS01965 (NCTC11940_00364) - 409751..410809 (+) 1059 WP_000784024.1 superantigen-like protein SSL3 -
  DQM92_RS01970 - 410928..411065 (+) 138 WP_001791691.1 hypothetical protein -
  DQM92_RS01975 (NCTC11940_00365) - 411174..412100 (+) 927 WP_000705644.1 superantigen-like protein SSL4 -
  DQM92_RS01980 (NCTC11940_00366) - 412464..413168 (+) 705 WP_000784244.1 superantigen-like protein SSL5 -
  DQM92_RS01985 (NCTC11940_00367) - 413614..414308 (+) 695 Protein_374 superantigen-like protein SSL6 -
  DQM92_RS01990 (NCTC11940_00369) - 414729..415424 (+) 696 WP_000769836.1 superantigen-like protein SSL7 -
  DQM92_RS01995 (NCTC11940_00370) - 415768..416466 (+) 699 WP_000673479.1 superantigen-like protein SSL8 -
  DQM92_RS02000 (NCTC11940_00371) - 416846..417544 (+) 699 WP_000779446.1 superantigen-like protein SSL9 -
  DQM92_RS02005 (NCTC11940_00372) - 417910..418593 (+) 684 WP_000673051.1 superantigen-like protein SSL10 -
  DQM92_RS02010 - 418678..418779 (-) 102 WP_010956543.1 hypothetical protein -
  DQM92_RS02015 (NCTC11940_00373) - 418857..420413 (+) 1557 WP_000028628.1 type I restriction-modification system subunit M -
  DQM92_RS02020 (NCTC11940_00374) - 420406..421617 (+) 1212 WP_000072584.1 restriction endonuclease subunit S -
  DQM92_RS02025 (NCTC11940_00375) - 422000..422677 (+) 678 WP_000769163.1 superantigen-like protein SSL11 -

Sequence


Protein


Download         Length: 167 a.a.        Molecular weight: 18571.18 Da        Isoelectric Point: 4.7305

>NTDB_id=1137924 DQM92_RS01620 WP_000934798.1 352255..352758(+) (ssbA) [Staphylococcus aureus strain NCTC11940]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVMCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF

Nucleotide


Download         Length: 504 bp        

>NTDB_id=1137924 DQM92_RS01620 WP_000934798.1 352255..352758(+) (ssbA) [Staphylococcus aureus strain NCTC11940]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTATGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0Z0SL74

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

65.341

100

0.689

  ssb Latilactobacillus sakei subsp. sakei 23K

54.386

100

0.557

  ssbB Bacillus subtilis subsp. subtilis str. 168

58.491

63.473

0.371

  ssb Glaesserella parasuis strain SC1401

34.463

100

0.365


Multiple sequence alignment