Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   DQL25_RS01770 Genome accession   NZ_LS483330
Coordinates   331964..332455 (+) Length   163 a.a.
NCBI ID   WP_111703139.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain NCTC8328     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 313375..378015 331964..332455 within 0


Gene organization within MGE regions


Location: 313375..378015
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DQL25_RS01680 (NCTC8328_00332) - 313375..314271 (-) 897 WP_002983050.1 sulfite exporter TauE/SafE family protein -
  DQL25_RS01685 (NCTC8328_00333) - 314569..315321 (+) 753 WP_002983053.1 CppA N-terminal domain-containing protein -
  DQL25_RS01690 (NCTC8328_00334) - 315306..316256 (+) 951 WP_111703135.1 serine hydrolase domain-containing protein -
  DQL25_RS01695 (NCTC8328_00335) pflB 316436..318763 (-) 2328 WP_002988233.1 formate C-acetyltransferase -
  DQL25_RS01700 (NCTC8328_00336) dinB 318972..320066 (+) 1095 WP_020905451.1 DNA polymerase IV -
  DQL25_RS01705 (NCTC8328_00337) - 320159..320641 (-) 483 WP_002983066.1 hypothetical protein -
  DQL25_RS01710 (NCTC8328_00338) - 320732..323185 (-) 2454 WP_063662393.1 ATP-dependent RecD-like DNA helicase -
  DQL25_RS01715 (NCTC8328_00339) lepB 323243..323836 (-) 594 WP_002983074.1 signal peptidase I -
  DQL25_RS01720 (NCTC8328_00340) rnhC 323847..324749 (-) 903 WP_002988245.1 ribonuclease HIII -
  DQL25_RS01725 (NCTC8328_00341) - 324906..325214 (+) 309 WP_002993251.1 hypothetical protein -
  DQL25_RS01730 (NCTC8328_00342) - 325217..325762 (+) 546 WP_002983087.1 CvpA family protein -
  DQL25_RS01735 (NCTC8328_00343) - 325911..328250 (+) 2340 WP_111703136.1 endonuclease MutS2 -
  DQL25_RS01740 (NCTC8328_00344) - 328254..328754 (+) 501 WP_168391425.1 phosphatase PAP2 family protein -
  DQL25_RS01745 (NCTC8328_00345) trxA 328817..329149 (+) 333 WP_001932060.1 thioredoxin -
  DQL25_RS01750 (NCTC8328_00346) - 329201..329788 (-) 588 WP_032462795.1 helix-turn-helix domain-containing protein -
  DQL25_RS01755 (NCTC8328_00347) mutY 329864..331018 (-) 1155 WP_002988276.1 A/G-specific adenine glycosylase -
  DQL25_RS01760 (NCTC8328_00348) - 331186..331479 (+) 294 WP_111703138.1 hypothetical protein -
  DQL25_RS01765 (NCTC8328_00349) rpsF 331652..331942 (+) 291 WP_002983117.1 30S ribosomal protein S6 -
  DQL25_RS01770 (NCTC8328_00350) ssb 331964..332455 (+) 492 WP_111703139.1 single-stranded DNA-binding protein Machinery gene
  DQL25_RS01775 (NCTC8328_00351) rpsR 332620..332859 (+) 240 WP_002983142.1 30S ribosomal protein S18 -
  DQL25_RS01780 (NCTC8328_00352) - 332990..333643 (-) 654 WP_111703140.1 DUF1129 domain-containing protein -
  DQL25_RS01785 (NCTC8328_00353) - 333776..334720 (-) 945 WP_002983147.1 magnesium transporter CorA family protein -
  DQL25_RS01790 (NCTC8328_00354) - 334964..336061 (-) 1098 WP_047149517.1 site-specific integrase -
  DQL25_RS01795 (NCTC8328_00355) - 336237..336788 (-) 552 WP_047149516.1 hypothetical protein -
  DQL25_RS01800 (NCTC8328_00356) - 336799..337182 (-) 384 WP_047149515.1 ImmA/IrrE family metallo-endopeptidase -
  DQL25_RS01805 (NCTC8328_00357) - 337196..337546 (-) 351 WP_011184049.1 helix-turn-helix domain-containing protein -
  DQL25_RS01810 (NCTC8328_00358) - 338187..338378 (+) 192 WP_001283052.1 hypothetical protein -
  DQL25_RS01815 (NCTC8328_00359) - 338429..338629 (+) 201 WP_227868729.1 hypothetical protein -
  DQL25_RS01820 (NCTC8328_00360) - 338717..338974 (+) 258 WP_047149513.1 hypothetical protein -
  DQL25_RS01825 (NCTC8328_00361) - 339003..339173 (+) 171 WP_023611037.1 hypothetical protein -
  DQL25_RS01830 (NCTC8328_00362) - 339166..339369 (+) 204 WP_047149512.1 hypothetical protein -
  DQL25_RS01835 (NCTC8328_00363) - 339366..339752 (+) 387 WP_047149511.1 hypothetical protein -
  DQL25_RS01840 (NCTC8328_00365) - 339898..340101 (+) 204 WP_030127426.1 hypothetical protein -
  DQL25_RS01845 (NCTC8328_00366) - 340189..340488 (+) 300 WP_030127427.1 hypothetical protein -
  DQL25_RS01850 (NCTC8328_00367) - 340488..341645 (+) 1158 WP_011888943.1 DUF2800 domain-containing protein -
  DQL25_RS01855 (NCTC8328_00368) - 341654..342217 (+) 564 WP_086934854.1 DUF2815 family protein -
  DQL25_RS01860 (NCTC8328_00369) - 342260..344182 (+) 1923 WP_047149510.1 DNA polymerase -
  DQL25_RS01865 (NCTC8328_00370) - 344187..346571 (+) 2385 WP_111689469.1 phage/plasmid primase, P4 family -
  DQL25_RS01870 (NCTC8328_00371) - 346957..347232 (+) 276 WP_011054885.1 VRR-NUC domain-containing protein -
  DQL25_RS01875 (NCTC8328_00372) - 347229..348551 (+) 1323 WP_047149508.1 SNF2-related protein -
  DQL25_RS09555 (NCTC8328_00373) - 348552..348722 (+) 171 WP_011054883.1 hypothetical protein -
  DQL25_RS01880 (NCTC8328_00374) - 348715..348987 (+) 273 WP_011054882.1 hypothetical protein -
  DQL25_RS01885 (NCTC8328_00376) - 349120..349536 (+) 417 WP_011054881.1 transcriptional regulator -
  DQL25_RS01890 (NCTC8328_00377) - 349626..350078 (+) 453 WP_011106637.1 terminase small subunit -
  DQL25_RS01895 (NCTC8328_00378) - 350068..351345 (+) 1278 WP_011054879.1 PBSX family phage terminase large subunit -
  DQL25_RS01900 (NCTC8328_00379) - 351361..352893 (+) 1533 WP_038433243.1 phage portal protein -
  DQL25_RS01905 (NCTC8328_00380) - 352853..354301 (+) 1449 WP_032465703.1 minor capsid protein -
  DQL25_RS01910 - 354329..354517 (+) 189 WP_011054876.1 hypothetical protein -
  DQL25_RS01915 (NCTC8328_00382) - 354522..354788 (+) 267 WP_011888934.1 hypothetical protein -
  DQL25_RS01920 (NCTC8328_00383) - 354950..355519 (+) 570 WP_011888933.1 DUF4355 domain-containing protein -
  DQL25_RS01925 (NCTC8328_00384) - 355532..356419 (+) 888 WP_002983429.1 hypothetical protein -
  DQL25_RS01930 (NCTC8328_00385) - 356431..356787 (+) 357 WP_011888932.1 phage head-tail connector protein -
  DQL25_RS01935 (NCTC8328_00386) - 356798..357076 (+) 279 WP_011054872.1 hypothetical protein -
  DQL25_RS01940 (NCTC8328_00387) - 357073..357417 (+) 345 WP_011106640.1 HK97-gp10 family putative phage morphogenesis protein -
  DQL25_RS01945 (NCTC8328_00388) - 357421..357780 (+) 360 WP_011054870.1 hypothetical protein -
  DQL25_RS01950 (NCTC8328_00389) - 357792..358391 (+) 600 WP_011054869.1 phage major tail protein, TP901-1 family -
  DQL25_RS01955 (NCTC8328_00390) - 358445..358900 (+) 456 WP_011888931.1 tail assembly chaperone -
  DQL25_RS01960 (NCTC8328_00391) - 358975..359208 (+) 234 WP_011888930.1 hypothetical protein -
  DQL25_RS01965 (NCTC8328_00392) - 359223..363605 (+) 4383 WP_111688404.1 tape measure protein -
  DQL25_RS01970 (NCTC8328_00393) - 363617..364459 (+) 843 WP_011054865.1 phage tail family protein -
  DQL25_RS01975 (NCTC8328_00394) - 364469..366448 (+) 1980 WP_011888928.1 phage tail protein -
  DQL25_RS01980 (NCTC8328_00395) - 366445..367560 (+) 1116 WP_011888927.1 hyaluronoglucosaminidase -
  DQL25_RS01985 (NCTC8328_00396) - 367575..369479 (+) 1905 WP_011017395.1 gp58-like family protein -
  DQL25_RS01990 (NCTC8328_00397) - 369491..369919 (+) 429 WP_002988448.1 DUF1617 family protein -
  DQL25_RS01995 (NCTC8328_00398) - 369922..370560 (+) 639 WP_046735270.1 hypothetical protein -
  DQL25_RS02000 (NCTC8328_00399) - 370572..370844 (+) 273 WP_011017397.1 hypothetical protein -
  DQL25_RS02005 (NCTC8328_00400) - 370841..371068 (+) 228 WP_029714020.1 phage holin -
  DQL25_RS02010 (NCTC8328_00402) - 371191..372396 (+) 1206 WP_047149505.1 glucosaminidase domain-containing protein -
  DQL25_RS02015 (NCTC8328_00404) prx 373093..373275 (+) 183 WP_047149504.1 hypothetical protein Regulator
  DQL25_RS02020 (NCTC8328_00405) uvrA 373502..376330 (+) 2829 WP_011054967.1 excinuclease ABC subunit UvrA -
  DQL25_RS02025 (NCTC8328_00406) - 376446..377519 (+) 1074 WP_032460474.1 M24 family metallopeptidase -
  DQL25_RS02030 (NCTC8328_00407) - 377554..378015 (+) 462 WP_002988493.1 deoxycytidylate deaminase -

Sequence


Protein


Download         Length: 163 a.a.        Molecular weight: 18025.81 Da        Isoelectric Point: 4.8894

>NTDB_id=1136845 DQL25_RS01770 WP_111703139.1 331964..332455(+) (ssb) [Streptococcus pyogenes strain NCTC8328]
MINNVVLVGRMTKDAELRYTPSQVAVATFTLAVNRTFKSQNGEREADFINCVIWRQPAENLANWAKKGALIGITGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRATREGGSTGSFNSGFNNNTSSSNSYSAPAQQTPNFGRDDSPFGNSNPMDISDDD
LPF

Nucleotide


Download         Length: 492 bp        

>NTDB_id=1136845 DQL25_RS01770 WP_111703139.1 331964..332455(+) (ssb) [Streptococcus pyogenes strain NCTC8328]
ATGATTAATAATGTAGTACTAGTTGGTCGCATGACCAAGGATGCAGAACTTCGTTACACACCAAGTCAAGTAGCTGTGGC
TACCTTCACACTTGCTGTTAACCGTACCTTTAAAAGCCAAAATGGTGAGCGCGAGGCAGATTTCATTAACTGTGTGATCT
GGCGCCAACCTGCTGAAAATTTAGCAAACTGGGCTAAAAAAGGTGCCTTGATCGGAATTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGGACAACGTGTCTATGTAACAGAAGTTGTTGCAGATAATTTCCAAATGTTGGAAAGCCGTGC
TACACGTGAAGGTGGCTCAACTGGCTCATTTAATAGTGGGTTTAACAATAACACTTCATCATCAAACAGTTACTCAGCGC
CTGCACAACAAACACCTAACTTTGGAAGAGATGATAGCCCATTTGGCAATTCAAACCCGATGGATATCTCAGATGACGAT
CTTCCATTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

59.884

100

0.632

  ssbA Bacillus subtilis subsp. subtilis str. 168

57.143

100

0.613

  ssbB Bacillus subtilis subsp. subtilis str. 168

56.604

65.031

0.368


Multiple sequence alignment