Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   D934_RS11420 Genome accession   NZ_CP006696
Coordinates   2443039..2443485 (+) Length   148 a.a.
NCBI ID   WP_020852950.1    Uniprot ID   A0A060H1M4
Organism   Xylella fastidiosa subsp. sandyi Ann-1     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2428131..2468690 2443039..2443485 within 0


Gene organization within MGE regions


Location: 2428131..2468690
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D934_RS11295 (D934_12135) - 2428131..2428646 (-) 516 WP_020852292.1 phage portal protein -
  D934_RS15355 (D934_12140) - 2428643..2428879 (-) 237 WP_024749052.1 hypothetical protein -
  D934_RS11305 (D934_12145) - 2428956..2431055 (-) 2100 WP_042836615.1 phage terminase large subunit family protein -
  D934_RS11310 (D934_12150) - 2431052..2431651 (-) 600 WP_020853062.1 hypothetical protein -
  D934_RS11320 (D934_12160) - 2432048..2433553 (-) 1506 WP_042836619.1 VapE domain-containing protein -
  D934_RS11325 (D934_12165) - 2433550..2434605 (-) 1056 WP_042836620.1 DNA primase -
  D934_RS11330 (D934_12170) - 2434604..2435005 (+) 402 WP_024748708.1 hypothetical protein -
  D934_RS11335 (D934_12175) - 2435107..2435730 (-) 624 WP_020852705.1 hypothetical protein -
  D934_RS11340 (D934_12180) - 2435788..2436138 (-) 351 WP_042836623.1 hypothetical protein -
  D934_RS11345 (D934_12185) - 2436125..2436421 (-) 297 WP_042836624.1 transcriptional regulator -
  D934_RS11350 (D934_12190) - 2436498..2436929 (+) 432 WP_004086786.1 hypothetical protein -
  D934_RS11355 (D934_12195) - 2437044..2437511 (+) 468 WP_042836716.1 hypothetical protein -
  D934_RS11360 (D934_12200) - 2437717..2438025 (-) 309 WP_051604013.1 hypothetical protein -
  D934_RS11365 (D934_12205) - 2438064..2438342 (-) 279 WP_230577808.1 hypothetical protein -
  D934_RS11370 (D934_12210) - 2438528..2438926 (+) 399 WP_042836626.1 hypothetical protein -
  D934_RS11375 (D934_12215) - 2439160..2439648 (-) 489 WP_020853051.1 hypothetical protein -
  D934_RS15545 - 2439642..2439764 (+) 123 WP_267959251.1 hypothetical protein -
  D934_RS15360 - 2439816..2440103 (+) 288 WP_020853052.1 hypothetical protein -
  D934_RS11380 (D934_12225) - 2440087..2440566 (+) 480 WP_020853053.1 DUF1566 domain-containing protein -
  D934_RS11385 (D934_12230) - 2440563..2441012 (+) 450 WP_020852697.1 hypothetical protein -
  D934_RS11390 (D934_12235) - 2441009..2441230 (+) 222 WP_021358638.1 hypothetical protein -
  D934_RS11395 (D934_12240) - 2441227..2441505 (+) 279 WP_020853056.1 hypothetical protein -
  D934_RS11400 (D934_12245) - 2441502..2441768 (+) 267 WP_020853057.1 hypothetical protein -
  D934_RS14875 - 2441761..2441922 (+) 162 WP_196242785.1 hypothetical protein -
  D934_RS11405 (D934_12250) - 2441900..2442433 (+) 534 WP_020852695.1 pilin -
  D934_RS15625 - 2442526..2442690 (+) 165 Protein_2289 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase -
  D934_RS11415 (D934_12260) - 2442849..2443055 (+) 207 WP_230577747.1 hypothetical protein -
  D934_RS11420 (D934_12265) ssb 2443039..2443485 (+) 447 WP_020852950.1 single-stranded DNA-binding protein Machinery gene
  D934_RS11425 (D934_12270) - 2443507..2443779 (+) 273 WP_020852746.1 hypothetical protein -
  D934_RS11430 (D934_12275) - 2443779..2444918 (+) 1140 Protein_2293 integrase -
  D934_RS11435 - 2445342..2445815 (+) 474 WP_020852945.1 DUF488 domain-containing protein -
  D934_RS11440 (D934_12280) - 2445772..2446605 (-) 834 WP_020852944.1 hypothetical protein -
  D934_RS11445 (D934_12290) - 2447164..2447712 (+) 549 WP_024749081.1 type II toxin-antitoxin system antitoxin SocA domain-containing protein -
  D934_RS11450 (D934_12295) - 2447672..2448268 (+) 597 WP_024749080.1 hypothetical protein -
  D934_RS11455 (D934_12300) - 2448285..2448509 (+) 225 WP_230577809.1 hypothetical protein -
  D934_RS11460 (D934_12305) - 2448510..2449673 (-) 1164 WP_020851649.1 tail fiber protein -
  D934_RS11465 (D934_12310) - 2449677..2450237 (-) 561 WP_020851650.1 DUF2612 domain-containing protein -
  D934_RS11470 (D934_12315) - 2450234..2451379 (-) 1146 WP_020851651.1 baseplate J/gp47 family protein -
  D934_RS11475 (D934_12320) - 2451478..2451774 (+) 297 WP_004089252.1 type II toxin-antitoxin system RelE/ParE family toxin -
  D934_RS11480 (D934_12325) - 2451778..2452083 (+) 306 WP_004089254.1 addiction module antidote protein -
  D934_RS11485 (D934_12330) - 2452094..2452447 (-) 354 WP_020851652.1 hypothetical protein -
  D934_RS11490 (D934_12335) - 2452444..2453085 (-) 642 WP_020851653.1 Gp138 family membrane-puncturing spike protein -
  D934_RS11495 (D934_12340) - 2453082..2453912 (-) 831 WP_042836628.1 hypothetical protein -
  D934_RS11500 (D934_12345) - 2453909..2454226 (-) 318 WP_020851655.1 hypothetical protein -
  D934_RS11505 (D934_12350) - 2454226..2454996 (-) 771 WP_024749165.1 phage baseplate protein -
  D934_RS11510 (D934_12355) - 2455054..2455380 (+) 327 WP_004091353.1 type II toxin-antitoxin system RelE/ParE family toxin -
  D934_RS11515 (D934_12360) - 2455377..2455658 (+) 282 WP_004091355.1 XRE family transcriptional regulator -
  D934_RS14555 (D934_12365) - 2455717..2456010 (-) 294 Protein_2311 hypothetical protein -
  D934_RS11520 (D934_12370) - 2456012..2456233 (-) 222 Protein_2312 phage baseplate protein -
  D934_RS11525 (D934_12375) - 2456321..2456620 (+) 300 WP_024749166.1 type II toxin-antitoxin system RelE/ParE family toxin -
  D934_RS11530 (D934_12380) - 2456624..2456932 (+) 309 WP_004085003.1 addiction module antidote protein -
  D934_RS11535 (D934_12385) - 2457006..2458895 (-) 1890 WP_042836631.1 hypothetical protein -
  D934_RS11540 (D934_12390) - 2459043..2459465 (-) 423 WP_020852390.1 phage tail assembly chaperone -
  D934_RS11545 (D934_12395) - 2459462..2459899 (-) 438 WP_004087249.1 phage protein -
  D934_RS14090 (D934_12400) - 2459909..2460136 (-) 228 WP_080702514.1 DUF3383 family protein -
  D934_RS11550 (D934_12405) - 2460362..2461231 (-) 870 WP_020851662.1 RNA-guided endonuclease TnpB family protein -
  D934_RS15370 (D934_12410) - 2461210..2461518 (-) 309 WP_020851663.1 helix-turn-helix domain-containing protein -
  D934_RS11555 - 2461550..2462167 (-) 618 Protein_2321 IS607 family transposase -
  D934_RS11560 (D934_12425) - 2462239..2462838 (+) 600 WP_020851666.1 hypothetical protein -
  D934_RS11565 (D934_12430) - 2462835..2463113 (+) 279 WP_020851667.1 VRR-NUC domain-containing protein -
  D934_RS15375 (D934_12435) - 2463115..2463405 (-) 291 WP_038274391.1 hypothetical protein -
  D934_RS11575 (D934_12440) - 2463475..2463921 (-) 447 WP_024749168.1 hypothetical protein -
  D934_RS11580 (D934_12445) - 2464006..2465424 (+) 1419 WP_020852570.1 DEAD/DEAH box helicase -
  D934_RS14100 (D934_12450) - 2465421..2465666 (+) 246 WP_080702516.1 DUF4224 domain-containing protein -
  D934_RS11585 (D934_12455) - 2465666..2466685 (+) 1020 WP_020852569.1 tyrosine-type recombinase/integrase -
  D934_RS11590 (D934_12460) - 2466753..2468690 (-) 1938 WP_020852568.1 ABC-F family ATP-binding cassette domain-containing protein -

Sequence


Protein


Download         Length: 148 a.a.        Molecular weight: 16605.49 Da        Isoelectric Point: 7.3543

>NTDB_id=113587 D934_RS11420 WP_020852950.1 2443039..2443485(+) (ssb) [Xylella fastidiosa subsp. sandyi Ann-1]
MARGINKVILVGNLGNEPDIKYTQSGMTITNISLATSSKRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGNDGQDRYVTEIIANQMHMLGGRGEGSSGITPQQRPAKVRNNDKAYAYAGDDFHDDDIPF

Nucleotide


Download         Length: 447 bp        

>NTDB_id=113587 D934_RS11420 WP_020852950.1 2443039..2443485(+) (ssb) [Xylella fastidiosa subsp. sandyi Ann-1]
ATGGCACGCGGAATTAACAAGGTAATCCTAGTCGGCAACCTGGGGAACGAGCCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAACATTAGCCTAGCAACCAGCAGCAAACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTGGGCGAGATTGCCGCCGAATATCTGCACAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAATTCACCGGCAATGATGGGCAGGACCGTTATGTCACTGAGATTATTGCTAACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGCATCACGCCACAGCAGCGACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A060H1M4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

42.045

100

0.5

  ssb Neisseria meningitidis MC58

39.306

100

0.459

  ssb Neisseria gonorrhoeae MS11

39.306

100

0.459

  ssb Glaesserella parasuis strain SC1401

42.029

93.243

0.392


Multiple sequence alignment