Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | D934_RS07785 | Genome accession | NZ_CP006696 |
| Coordinates | 1684800..1685243 (-) | Length | 147 a.a. |
| NCBI ID | WP_020852400.1 | Uniprot ID | A0A060H3N6 |
| Organism | Xylella fastidiosa subsp. sandyi Ann-1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1675562..1727807 | 1684800..1685243 | within | 0 |
Gene organization within MGE regions
Location: 1675562..1727807
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D934_RS07740 (D934_08310) | - | 1675562..1676074 (+) | 513 | WP_020851181.1 | Tfp pilus assembly protein FimT/FimU | - |
| D934_RS07745 (D934_08315) | pilV | 1676071..1676553 (+) | 483 | WP_020851180.1 | type IV pilus modification protein PilV | - |
| D934_RS07750 (D934_08320) | - | 1676550..1677806 (+) | 1257 | WP_020851179.1 | PilW family protein | - |
| D934_RS07755 (D934_08325) | - | 1677806..1678300 (+) | 495 | WP_020851178.1 | PilX N-terminal domain-containing pilus assembly protein | - |
| D934_RS07760 (D934_08330) | - | 1678304..1682869 (+) | 4566 | WP_024749087.1 | pilus assembly protein | - |
| D934_RS07765 (D934_08335) | - | 1682866..1683321 (+) | 456 | WP_012382713.1 | type IV pilin protein | - |
| D934_RS07775 (D934_08345) | - | 1683589..1684566 (-) | 978 | WP_020852399.1 | tyrosine-type recombinase/integrase | - |
| D934_RS07780 (D934_08350) | - | 1684568..1684822 (-) | 255 | WP_024749085.1 | DUF4224 domain-containing protein | - |
| D934_RS07785 (D934_08355) | ssb | 1684800..1685243 (-) | 444 | WP_020852400.1 | single-stranded DNA-binding protein | Machinery gene |
| D934_RS07790 (D934_08360) | - | 1685301..1686014 (-) | 714 | WP_020852401.1 | phage antirepressor KilAC domain-containing protein | - |
| D934_RS07795 | - | 1686011..1686619 (-) | 609 | WP_020852402.1 | Bro-N domain-containing protein | - |
| D934_RS14465 | - | 1686713..1687033 (+) | 321 | WP_155266652.1 | hypothetical protein | - |
| D934_RS07800 (D934_08375) | - | 1686970..1688604 (-) | 1635 | WP_042836520.1 | lambda-exonuclease family protein | - |
| D934_RS07805 (D934_08380) | bet | 1688601..1689536 (-) | 936 | WP_042836522.1 | phage recombination protein Bet | - |
| D934_RS07810 (D934_08385) | - | 1689552..1690373 (-) | 822 | WP_042836523.1 | DUF2303 family protein | - |
| D934_RS07815 (D934_08390) | - | 1690413..1690757 (-) | 345 | WP_042836525.1 | hypothetical protein | - |
| D934_RS07820 (D934_08395) | - | 1690778..1690969 (-) | 192 | WP_024748588.1 | hypothetical protein | - |
| D934_RS15195 | - | 1690992..1691138 (-) | 147 | WP_225621633.1 | hypothetical protein | - |
| D934_RS07825 (D934_08400) | - | 1691314..1691505 (-) | 192 | WP_004086365.1 | hypothetical protein | - |
| D934_RS07830 (D934_08405) | - | 1691502..1691909 (-) | 408 | WP_042836702.1 | hypothetical protein | - |
| D934_RS07835 (D934_08410) | - | 1692066..1692590 (+) | 525 | WP_042836527.1 | hypothetical protein | - |
| D934_RS07840 (D934_08415) | - | 1692710..1693114 (+) | 405 | WP_042836703.1 | hypothetical protein | - |
| D934_RS13635 | - | 1693266..1693469 (+) | 204 | WP_080702476.1 | hypothetical protein | - |
| D934_RS13025 (D934_08420) | - | 1693432..1694229 (+) | 798 | WP_020851949.1 | hypothetical protein | - |
| D934_RS07850 (D934_08425) | - | 1694415..1695479 (-) | 1065 | WP_080702477.1 | XRE family transcriptional regulator | - |
| D934_RS13640 | - | 1695478..1695732 (+) | 255 | WP_080702478.1 | helix-turn-helix domain-containing protein | - |
| D934_RS14780 | - | 1695722..1696219 (+) | 498 | WP_020851951.1 | hypothetical protein | - |
| D934_RS07865 (D934_08435) | - | 1696280..1696468 (+) | 189 | WP_020851634.1 | hypothetical protein | - |
| D934_RS07870 (D934_08440) | - | 1696465..1696713 (+) | 249 | WP_024748753.1 | hypothetical protein | - |
| D934_RS14470 (D934_08445) | - | 1696995..1697636 (+) | 642 | WP_020851952.1 | Bro-N domain-containing protein | - |
| D934_RS13665 (D934_08450) | - | 1697633..1698244 (+) | 612 | WP_020851953.1 | BRO family protein | - |
| D934_RS07890 (D934_08455) | - | 1698241..1698831 (+) | 591 | WP_020851954.1 | Bro-N domain-containing protein | - |
| D934_RS07895 (D934_08460) | - | 1698934..1700082 (+) | 1149 | WP_042836694.1 | BRO family protein | - |
| D934_RS07900 (D934_08465) | - | 1700079..1700339 (+) | 261 | WP_230577760.1 | hypothetical protein | - |
| D934_RS07905 (D934_08470) | - | 1700341..1701183 (+) | 843 | WP_020853092.1 | hypothetical protein | - |
| D934_RS07910 (D934_08475) | dnaB | 1701180..1702640 (+) | 1461 | WP_020853093.1 | replicative DNA helicase | - |
| D934_RS07915 (D934_08480) | - | 1702646..1703052 (+) | 407 | Protein_1561 | hypothetical protein | - |
| D934_RS07920 (D934_13700) | - | 1703182..1703882 (+) | 701 | Protein_1562 | hypothetical protein | - |
| D934_RS07925 (D934_08485) | - | 1704071..1704337 (+) | 267 | WP_004089577.1 | BrnT family toxin | - |
| D934_RS07930 (D934_08490) | - | 1704324..1704662 (+) | 339 | WP_004089578.1 | BrnA antitoxin family protein | - |
| D934_RS07935 (D934_08495) | - | 1704866..1705366 (+) | 501 | WP_020852372.1 | lysozyme | - |
| D934_RS07940 (D934_08500) | - | 1705359..1705688 (+) | 330 | WP_020852373.1 | phage holin family protein | - |
| D934_RS07945 (D934_08505) | - | 1705678..1706139 (+) | 462 | WP_020852374.1 | hypothetical protein | - |
| D934_RS07950 (D934_08510) | - | 1706189..1706353 (+) | 165 | WP_196242786.1 | hypothetical protein | - |
| D934_RS07955 (D934_08515) | - | 1706445..1706843 (+) | 399 | WP_020852375.1 | hypothetical protein | - |
| D934_RS07960 (D934_08520) | terL | 1706794..1708344 (+) | 1551 | WP_020852376.1 | phage terminase large subunit | - |
| D934_RS07965 (D934_08525) | - | 1708341..1709729 (+) | 1389 | WP_196242787.1 | DUF1073 domain-containing protein | - |
| D934_RS07970 (D934_08530) | - | 1709778..1710059 (-) | 282 | WP_020852378.1 | helix-turn-helix domain-containing protein | - |
| D934_RS07975 (D934_08535) | - | 1710056..1710394 (-) | 339 | WP_020852379.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| D934_RS07980 (D934_08540) | - | 1710467..1711312 (+) | 846 | WP_020852380.1 | phage minor head protein | - |
| D934_RS07985 (D934_08545) | - | 1711312..1712520 (+) | 1209 | WP_024748896.1 | DUF2213 domain-containing protein | - |
| D934_RS07990 (D934_08550) | - | 1712530..1713012 (+) | 483 | WP_020852382.1 | hypothetical protein | - |
| D934_RS07995 (D934_08555) | - | 1713022..1714005 (+) | 984 | WP_024748895.1 | DUF2184 domain-containing protein | - |
| D934_RS08000 (D934_08560) | - | 1714068..1714421 (+) | 354 | WP_020852384.1 | hypothetical protein | - |
| D934_RS08005 (D934_08565) | - | 1714421..1714789 (+) | 369 | WP_024748894.1 | DUF4054 domain-containing protein | - |
| D934_RS08010 (D934_08570) | - | 1714945..1715265 (+) | 321 | WP_230577762.1 | hypothetical protein | - |
| D934_RS08015 (D934_08575) | - | 1715240..1715620 (+) | 381 | WP_020852387.1 | hypothetical protein | - |
| D934_RS08020 (D934_08580) | - | 1715544..1716077 (+) | 534 | WP_020852388.1 | hypothetical protein | - |
| D934_RS08025 (D934_08585) | - | 1716078..1717574 (+) | 1497 | WP_020852389.1 | DUF3383 domain-containing protein | - |
| D934_RS08030 (D934_08590) | - | 1717584..1718021 (+) | 438 | WP_004087249.1 | phage protein | - |
| D934_RS08035 (D934_08595) | - | 1718018..1718440 (+) | 423 | WP_020851660.1 | phage tail assembly chaperone | - |
| D934_RS08040 (D934_08600) | - | 1718588..1720477 (+) | 1890 | WP_020851659.1 | phage-related protein | - |
| D934_RS08045 (D934_08605) | - | 1720488..1720880 (-) | 393 | WP_020851658.1 | type II toxin-antitoxin system VapC family toxin | - |
| D934_RS08050 (D934_08610) | - | 1720889..1721161 (-) | 273 | WP_024748527.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| D934_RS08055 (D934_08615) | - | 1721321..1722091 (+) | 771 | WP_020851656.1 | phage baseplate protein | - |
| D934_RS08060 (D934_08620) | - | 1722091..1722408 (+) | 318 | WP_020851655.1 | hypothetical protein | - |
| D934_RS08065 (D934_08625) | - | 1722405..1723235 (+) | 831 | WP_020851654.1 | hypothetical protein | - |
| D934_RS08070 (D934_08630) | - | 1723232..1723873 (+) | 642 | WP_020851653.1 | Gp138 family membrane-puncturing spike protein | - |
| D934_RS08075 (D934_08635) | - | 1723870..1724223 (+) | 354 | WP_020851652.1 | hypothetical protein | - |
| D934_RS08080 (D934_08640) | - | 1724234..1724539 (-) | 306 | WP_004089254.1 | addiction module antidote protein | - |
| D934_RS08085 (D934_08645) | - | 1724543..1724839 (-) | 297 | WP_004089252.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| D934_RS08090 (D934_08650) | - | 1724938..1726083 (+) | 1146 | WP_020851651.1 | baseplate J/gp47 family protein | - |
| D934_RS08095 (D934_08655) | - | 1726080..1726640 (+) | 561 | WP_020851650.1 | DUF2612 domain-containing protein | - |
| D934_RS08100 (D934_08660) | - | 1726644..1727807 (+) | 1164 | WP_020851649.1 | tail fiber protein | - |
Sequence
Protein
Download Length: 147 a.a. Molecular weight: 16775.95 Da Isoelectric Point: 9.2754
>NTDB_id=113583 D934_RS07785 WP_020852400.1 1684800..1685243(-) (ssb) [Xylella fastidiosa subsp. sandyi Ann-1]
MARGINKVILVGNLGNEPDIKYTQSGMTITNISLATSSKRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
AIRYDKFTGQERYVTEIIADQMHMLGGRGEGSKGSPRKTVLPRQRSDKNAYKTWKEEEVVDDEIPFF
MARGINKVILVGNLGNEPDIKYTQSGMTITNISLATSSKRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
AIRYDKFTGQERYVTEIIADQMHMLGGRGEGSKGSPRKTVLPRQRSDKNAYKTWKEEEVVDDEIPFF
Nucleotide
Download Length: 444 bp
>NTDB_id=113583 D934_RS07785 WP_020852400.1 1684800..1685243(-) (ssb) [Xylella fastidiosa subsp. sandyi Ann-1]
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAGCCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAACATTAGCCTAGCAACCAGCAGCAAACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTGGGCGAGATTGCCGCCGAATATCTGCACAAGGGATCGCAGTGCTACATAGAGGGT
GCCATTCGCTACGACAAGTTCACCGGCCAGGAGCGTTATGTCACTGAGATTATTGCTGACCAAATGCACATGCTTGGCGG
TCGCGGTGAAGGCTCCAAAGGAAGCCCAAGAAAAACGGTATTACCGCGTCAGCGATCAGATAAAAACGCTTACAAAACCT
GGAAAGAAGAGGAGGTTGTCGATGACGAGATTCCGTTCTTCTGA
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAGCCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAACATTAGCCTAGCAACCAGCAGCAAACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTGGGCGAGATTGCCGCCGAATATCTGCACAAGGGATCGCAGTGCTACATAGAGGGT
GCCATTCGCTACGACAAGTTCACCGGCCAGGAGCGTTATGTCACTGAGATTATTGCTGACCAAATGCACATGCTTGGCGG
TCGCGGTGAAGGCTCCAAAGGAAGCCCAAGAAAAACGGTATTACCGCGTCAGCGATCAGATAAAAACGCTTACAAAACCT
GGAAAGAAGAGGAGGTTGTCGATGACGAGATTCCGTTCTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
41.143 |
100 |
0.49 |
| ssb | Neisseria gonorrhoeae MS11 |
46.957 |
78.231 |
0.367 |
| ssb | Neisseria meningitidis MC58 |
46.957 |
78.231 |
0.367 |