Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | D934_RS07140 | Genome accession | NZ_CP006696 |
| Coordinates | 1553964..1554410 (-) | Length | 148 a.a. |
| NCBI ID | WP_020852692.1 | Uniprot ID | A0A060H9R4 |
| Organism | Xylella fastidiosa subsp. sandyi Ann-1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1551656..1593483 | 1553964..1554410 | within | 0 |
Gene organization within MGE regions
Location: 1551656..1593483
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D934_RS07120 (D934_07635) | queC | 1551656..1552348 (+) | 693 | WP_020852689.1 | 7-cyano-7-deazaguanine synthase QueC | - |
| D934_RS07130 (D934_07645) | - | 1552486..1553670 (-) | 1185 | WP_024749268.1 | hypothetical protein | - |
| D934_RS07135 (D934_07650) | - | 1553670..1553945 (-) | 276 | WP_038274650.1 | hypothetical protein | - |
| D934_RS07140 (D934_07655) | ssb | 1553964..1554410 (-) | 447 | WP_020852692.1 | single-stranded DNA-binding protein | Machinery gene |
| D934_RS07145 (D934_07660) | - | 1554394..1554600 (-) | 207 | WP_230577747.1 | hypothetical protein | - |
| D934_RS15600 | - | 1554759..1554923 (-) | 165 | Protein_1405 | UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase | - |
| D934_RS07155 (D934_07670) | - | 1555016..1555549 (-) | 534 | WP_020852695.1 | pilin | - |
| D934_RS14755 | - | 1555527..1555688 (-) | 162 | WP_196242785.1 | hypothetical protein | - |
| D934_RS07160 (D934_07675) | - | 1555681..1555947 (-) | 267 | WP_020853057.1 | hypothetical protein | - |
| D934_RS07165 (D934_07680) | - | 1555944..1556222 (-) | 279 | WP_020853056.1 | hypothetical protein | - |
| D934_RS07170 (D934_07685) | - | 1556219..1556440 (-) | 222 | WP_021358638.1 | hypothetical protein | - |
| D934_RS07175 (D934_07690) | - | 1556437..1556886 (-) | 450 | WP_020852697.1 | hypothetical protein | - |
| D934_RS07180 (D934_07695) | - | 1556883..1557353 (-) | 471 | WP_020852698.1 | DUF1566 domain-containing protein | - |
| D934_RS07185 (D934_07700) | - | 1557350..1557811 (-) | 462 | WP_024748647.1 | hypothetical protein | - |
| D934_RS14440 | - | 1557919..1558464 (-) | 546 | WP_024749191.1 | hypothetical protein | - |
| D934_RS07195 (D934_07715) | - | 1558527..1558925 (-) | 399 | WP_020852700.1 | hypothetical protein | - |
| D934_RS07200 (D934_07720) | - | 1559149..1559880 (-) | 732 | WP_155244272.1 | hypothetical protein | - |
| D934_RS07210 (D934_07730) | - | 1560491..1561450 (-) | 960 | WP_230577748.1 | helix-turn-helix transcriptional regulator | - |
| D934_RS07215 (D934_07735) | - | 1561578..1561817 (+) | 240 | WP_020852703.1 | helix-turn-helix domain-containing protein | - |
| D934_RS07220 (D934_07740) | - | 1561804..1562154 (+) | 351 | WP_230577749.1 | hypothetical protein | - |
| D934_RS07225 (D934_07745) | - | 1562212..1562835 (+) | 624 | WP_020852705.1 | hypothetical protein | - |
| D934_RS07230 (D934_07750) | - | 1562937..1563338 (-) | 402 | WP_024748708.1 | hypothetical protein | - |
| D934_RS07235 (D934_07755) | - | 1563337..1564392 (+) | 1056 | WP_020851153.1 | DNA primase | - |
| D934_RS07240 (D934_07760) | - | 1564389..1565858 (+) | 1470 | WP_020851152.1 | VapE domain-containing protein | - |
| D934_RS07245 (D934_07765) | - | 1566255..1566863 (+) | 609 | WP_020851151.1 | hypothetical protein | - |
| D934_RS07250 (D934_07770) | - | 1566860..1568959 (+) | 2100 | WP_020851150.1 | phage terminase large subunit family protein | - |
| D934_RS14450 | - | 1569036..1569272 (+) | 237 | WP_038228002.1 | hypothetical protein | - |
| D934_RS07255 (D934_07775) | - | 1569226..1570830 (+) | 1605 | WP_230577750.1 | phage portal protein | - |
| D934_RS07260 (D934_07780) | - | 1570827..1573142 (+) | 2316 | WP_020851147.1 | ClpP-like prohead protease/major capsid protein fusion protein | - |
| D934_RS15170 | - | 1573215..1573355 (+) | 141 | WP_020851146.1 | capsid cement protein | - |
| D934_RS07265 (D934_07785) | - | 1573327..1573587 (+) | 261 | WP_020851145.1 | capsid cement protein | - |
| D934_RS07270 (D934_07790) | - | 1573659..1573883 (+) | 225 | WP_024748645.1 | hypothetical protein | - |
| D934_RS07275 (D934_07795) | - | 1573876..1574457 (+) | 582 | WP_020851144.1 | lysozyme | - |
| D934_RS14760 | - | 1574457..1574600 (+) | 144 | WP_155244210.1 | hypothetical protein | - |
| D934_RS07280 (D934_07805) | - | 1574597..1575382 (+) | 786 | WP_024748523.1 | hypothetical protein | - |
| D934_RS07285 (D934_07810) | - | 1575379..1575699 (+) | 321 | WP_004086810.1 | hypothetical protein | - |
| D934_RS07290 (D934_07815) | - | 1575696..1576169 (+) | 474 | WP_020851142.1 | hypothetical protein | - |
| D934_RS07295 (D934_07820) | - | 1576166..1576915 (+) | 750 | WP_020851141.1 | hypothetical protein | - |
| D934_RS07300 (D934_07825) | - | 1576912..1577358 (+) | 447 | WP_020851140.1 | DUF6631 family protein | - |
| D934_RS14765 (D934_07830) | - | 1577355..1577522 (+) | 168 | WP_004086814.1 | hypothetical protein | - |
| D934_RS07305 (D934_07835) | - | 1577523..1580036 (+) | 2514 | WP_020851139.1 | hypothetical protein | - |
| D934_RS07310 (D934_07840) | - | 1580029..1581216 (+) | 1188 | WP_020851138.1 | hypothetical protein | - |
| D934_RS07315 (D934_07845) | - | 1581206..1582648 (+) | 1443 | WP_020851137.1 | DUF2163 domain-containing protein | - |
| D934_RS13020 (D934_07850) | - | 1582639..1583067 (+) | 429 | WP_004086822.1 | hypothetical protein | - |
| D934_RS07325 (D934_07855) | - | 1583064..1583300 (+) | 237 | WP_004087265.1 | hypothetical protein | - |
| D934_RS07330 (D934_07860) | - | 1583290..1586115 (+) | 2826 | WP_042836516.1 | vWA domain-containing protein | - |
| D934_RS07335 (D934_07865) | - | 1586108..1586620 (+) | 513 | WP_020851135.1 | hypothetical protein | - |
| D934_RS07340 (D934_07870) | - | 1586624..1587043 (+) | 420 | WP_004083636.1 | hypothetical protein | - |
| D934_RS07345 (D934_07875) | - | 1587143..1587814 (+) | 672 | WP_230577751.1 | hypothetical protein | - |
| D934_RS15175 (D934_07880) | - | 1587811..1588152 (+) | 342 | WP_020852814.1 | rhomboid family intramembrane serine protease | - |
| D934_RS07355 (D934_07885) | - | 1588302..1589306 (+) | 1005 | WP_020852813.1 | hypothetical protein | - |
| D934_RS15180 (D934_07890) | - | 1589373..1589537 (+) | 165 | WP_155244229.1 | hypothetical protein | - |
| D934_RS07360 (D934_07895) | - | 1589739..1590056 (-) | 318 | WP_004084245.1 | BrnA antitoxin family protein | - |
| D934_RS07365 (D934_07900) | - | 1590016..1590303 (-) | 288 | WP_004083921.1 | BrnT family toxin | - |
| D934_RS07370 (D934_07905) | - | 1590581..1590922 (-) | 342 | WP_004084103.1 | helix-turn-helix transcriptional regulator | - |
| D934_RS07375 (D934_07910) | - | 1591454..1591708 (-) | 255 | WP_020852812.1 | HigA family addiction module antitoxin | - |
| D934_RS07380 (D934_07915) | - | 1592356..1593429 (-) | 1074 | WP_020852810.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16692.56 Da Isoelectric Point: 6.8732
>NTDB_id=113582 D934_RS07140 WP_020852692.1 1553964..1554410(-) (ssb) [Xylella fastidiosa subsp. sandyi Ann-1]
MARGINKVILVGNLGNEPDIKYTQSGMTITNISLATSSKRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGNDGQDRYVTEIIADQMHMLGGRGEGSSGITPQRRPAKVRNNDKAYAYADDDFHDDDIPF
MARGINKVILVGNLGNEPDIKYTQSGMTITNISLATSSKRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGNDGQDRYVTEIIADQMHMLGGRGEGSSGITPQRRPAKVRNNDKAYAYADDDFHDDDIPF
Nucleotide
Download Length: 447 bp
>NTDB_id=113582 D934_RS07140 WP_020852692.1 1553964..1554410(-) (ssb) [Xylella fastidiosa subsp. sandyi Ann-1]
ATGGCACGCGGAATTAACAAGGTAATCCTAGTCGGCAACCTGGGGAACGAGCCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAACATTAGCCTAGCAACCAGCAGCAAACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTGGGCGAGATTGCCGCCGAATATCTGCACAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAATTCACCGGCAATGATGGGCAGGACCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGCATCACGCCACAGCGGCGACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGACGACGACTTCCACGATGACGACATCCCGTTCTAG
ATGGCACGCGGAATTAACAAGGTAATCCTAGTCGGCAACCTGGGGAACGAGCCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAACATTAGCCTAGCAACCAGCAGCAAACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTGGGCGAGATTGCCGCCGAATATCTGCACAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAATTCACCGGCAATGATGGGCAGGACCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGCATCACGCCACAGCGGCGACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGACGACGACTTCCACGATGACGACATCCCGTTCTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
41.477 |
100 |
0.493 |
| ssb | Neisseria meningitidis MC58 |
38.728 |
100 |
0.453 |
| ssb | Neisseria gonorrhoeae MS11 |
38.728 |
100 |
0.453 |
| ssb | Glaesserella parasuis strain SC1401 |
37.64 |
100 |
0.453 |