Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   JLZ94_RS07765 Genome accession   NZ_LR882978
Coordinates   1572968..1573474 (-) Length   168 a.a.
NCBI ID   WP_000098523.1    Uniprot ID   -
Organism   Escherichia coli isolate L3_CS7_E2980     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1568699..1611474 1572968..1573474 within 0


Gene organization within MGE regions


Location: 1568699..1611474
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JLZ94_RS07710 (ETECE2980_01903) torI 1568699..1568899 (-) 201 WP_001163428.1 response regulator inhibitor TorI -
  JLZ94_RS07715 (ETECE2980_01904) - 1568957..1569124 (-) 168 WP_032243330.1 hypothetical protein -
  JLZ94_RS07720 (ETECE2980_01905) - 1569283..1569561 (-) 279 WP_001388117.1 DUF4752 family protein -
  JLZ94_RS25695 - 1569561..1569812 (-) 252 Protein_1521 DUF551 domain-containing protein -
  JLZ94_RS07730 (ETECE2980_01907) - 1570357..1570743 (-) 387 WP_001388115.1 ead/Ea22-like family protein -
  JLZ94_RS07735 (ETECE2980_01908) - 1570762..1571490 (-) 729 WP_032243331.1 site-specific DNA-methyltransferase -
  JLZ94_RS07740 (ETECE2980_01909) - 1571487..1571639 (-) 153 WP_001388113.1 hypothetical protein -
  JLZ94_RS07745 (ETECE2980_01910) - 1571636..1571803 (-) 168 WP_001388112.1 DUF2737 family protein -
  JLZ94_RS07750 (ETECE2980_01911) - 1571800..1572090 (-) 291 WP_001388111.1 DUF5405 family protein -
  JLZ94_RS07755 (ETECE2980_01912) - 1572101..1572394 (-) 294 WP_001388110.1 phage anti-RecBCD protein -
  JLZ94_RS07760 (ETECE2980_01913) - 1572411..1572959 (-) 549 WP_001016186.1 3'-5' exonuclease -
  JLZ94_RS07765 (ETECE2980_01914) ssb 1572968..1573474 (-) 507 WP_000098523.1 single-stranded DNA-binding protein Machinery gene
  JLZ94_RS07770 (ETECE2980_01915) - 1573471..1573938 (-) 468 WP_000018646.1 HNH endonuclease -
  JLZ94_RS07775 (ETECE2980_01916) - 1573939..1574646 (-) 708 WP_000365280.1 Rad52/Rad22 family DNA repair protein -
  JLZ94_RS07780 (ETECE2980_01918) - 1574901..1575071 (-) 171 WP_001183771.1 hypothetical protein -
  JLZ94_RS07785 (ETECE2980_01919) - 1575266..1575736 (-) 471 WP_000167581.1 hypothetical protein -
  JLZ94_RS07790 (ETECE2980_01920) - 1575870..1576208 (-) 339 WP_000930322.1 hypothetical protein -
  JLZ94_RS07795 (ETECE2980_01921) - 1576211..1576516 (-) 306 WP_000256573.1 hypothetical protein -
  JLZ94_RS07800 - 1576831..1577481 (-) 651 WP_001095982.1 LexA family transcriptional regulator -
  JLZ94_RS07805 (ETECE2980_01923) - 1577562..1577747 (+) 186 WP_000276885.1 Cro/CI family transcriptional regulator -
  JLZ94_RS07810 (ETECE2980_01924) - 1577863..1578159 (+) 297 WP_001388108.1 CII family transcriptional regulator -
  JLZ94_RS07815 (ETECE2980_01925) - 1578192..1578353 (+) 162 WP_000166961.1 hypothetical protein -
  JLZ94_RS07820 (ETECE2980_01926) - 1578340..1579230 (+) 891 WP_001554884.1 hypothetical protein -
  JLZ94_RS07825 (ETECE2980_01927) - 1579220..1580656 (+) 1437 WP_001388106.1 DnaB-like helicase C-terminal domain-containing protein -
  JLZ94_RS07830 (ETECE2980_01928) - 1580656..1580925 (+) 270 WP_001036029.1 hypothetical protein -
  JLZ94_RS07835 (ETECE2980_01930) istA 1581145..1582167 (+) 1023 WP_001356151.1 IS21-like element IS100 family transposase -
  JLZ94_RS07840 (ETECE2980_01931) istB 1582164..1582946 (+) 783 WP_001317493.1 IS21-like element IS100kyp family helper ATPase IstB -
  JLZ94_RS26000 - 1583131..1583256 (+) 126 Protein_1545 HNH endonuclease signature motif containing protein -
  JLZ94_RS25705 - 1583311..1583574 (+) 264 WP_248698003.1 AP2 domain-containing protein -
  JLZ94_RS07850 (ETECE2980_01932) - 1583635..1583850 (+) 216 WP_000103679.1 hypothetical protein -
  JLZ94_RS07855 (ETECE2980_01933) - 1583861..1584097 (+) 237 WP_001281772.1 Lar family restriction alleviation protein -
  JLZ94_RS07860 (ETECE2980_01934) - 1584054..1584500 (+) 447 WP_001385995.1 recombination protein NinB -
  JLZ94_RS07865 (ETECE2980_01935) - 1584497..1585024 (+) 528 WP_001385994.1 phage N-6-adenine-methyltransferase -
  JLZ94_RS07870 - 1585021..1585122 (+) 102 Protein_1551 NinE family protein -
  JLZ94_RS07875 - 1585174..1585314 (+) 141 Protein_1552 nuclease domain-containing protein -
  JLZ94_RS07880 (ETECE2980_01937) - 1585311..1585673 (+) 363 WP_001008200.1 RusA family crossover junction endodeoxyribonuclease -
  JLZ94_RS07885 (ETECE2980_01938) - 1585670..1585858 (+) 189 WP_000994516.1 protein ninH -
  JLZ94_RS07890 (ETECE2980_01939) - 1585855..1586343 (+) 489 WP_001385993.1 antiterminator Q family protein -
  JLZ94_RS07905 (ETECE2980_01942) - 1586832..1587155 (+) 324 WP_000783734.1 phage holin, lambda family -
  JLZ94_RS07910 (ETECE2980_01943) - 1587139..1587615 (+) 477 WP_000229392.1 glycoside hydrolase family protein -
  JLZ94_RS07915 (ETECE2980_01944) - 1587612..1588049 (+) 438 WP_001385991.1 lysis protein -
  JLZ94_RS07920 (ETECE2980_01945) - 1588128..1588607 (+) 480 WP_000191869.1 DUF2829 domain-containing protein -
  JLZ94_RS07925 (ETECE2980_01946) - 1588903..1589064 (+) 162 WP_001704594.1 hypothetical protein -
  JLZ94_RS07930 (ETECE2980_01947) - 1589075..1589239 (+) 165 WP_001386098.1 hypothetical protein -
  JLZ94_RS07935 (ETECE2980_01948) - 1589379..1589621 (+) 243 WP_000807785.1 DUF2560 family protein -
  JLZ94_RS07940 (ETECE2980_01949) - 1589657..1590145 (+) 489 WP_024167798.1 DNA-packaging protein -
  JLZ94_RS07945 (ETECE2980_01950) - 1590123..1591622 (+) 1500 WP_000417851.1 terminase family protein -
  JLZ94_RS07950 (ETECE2980_01951) - 1591623..1593788 (+) 2166 WP_001386097.1 portal protein -
  JLZ94_RS07955 (ETECE2980_01952) - 1593802..1594713 (+) 912 WP_000373006.1 scaffold protein -
  JLZ94_RS07960 (ETECE2980_01953) - 1594713..1596008 (+) 1296 WP_001388950.1 P22 phage major capsid protein family protein -
  JLZ94_RS07965 (ETECE2980_01954) - 1596053..1596313 (+) 261 WP_024180326.1 hypothetical protein -
  JLZ94_RS07970 (ETECE2980_01955) - 1596291..1596791 (+) 501 WP_001054834.1 packaged DNA stabilization gp4 family protein -
  JLZ94_RS07975 (ETECE2980_01956) - 1596791..1598209 (+) 1419 WP_001386094.1 packaged DNA stabilization protein gp10 -
  JLZ94_RS07980 (ETECE2980_01957) - 1598209..1599057 (+) 849 WP_001388949.1 tail needle knob protein -
  JLZ94_RS07985 (ETECE2980_01958) - 1599057..1599524 (+) 468 WP_001386092.1 DUF2824 family protein -
  JLZ94_RS07990 (ETECE2980_01959) - 1599511..1600191 (+) 681 WP_001708097.1 hypothetical protein -
  JLZ94_RS07995 (ETECE2980_01960) - 1600201..1601541 (+) 1341 WP_001386090.1 phage DNA ejection protein -
  JLZ94_RS08000 (ETECE2980_01961) - 1601526..1603649 (+) 2124 WP_000224776.1 hypothetical protein -
  JLZ94_RS08005 (ETECE2980_01962) - 1603646..1603873 (-) 228 WP_000816058.1 hypothetical protein -
  JLZ94_RS08010 (ETECE2980_01963) - 1603902..1604462 (-) 561 WP_000627667.1 hypothetical protein -
  JLZ94_RS08015 (ETECE2980_01964) - 1604470..1604748 (-) 279 WP_000132668.1 hypothetical protein -
  JLZ94_RS08020 (ETECE2980_01965) - 1604751..1604999 (-) 249 WP_021514397.1 Arc family DNA-binding protein -
  JLZ94_RS08025 (ETECE2980_01966) - 1605105..1605245 (+) 141 WP_001386205.1 Arc family DNA-binding protein -
  JLZ94_RS08030 (ETECE2980_01968) - 1605508..1606386 (+) 879 WP_001386203.1 phage repressor protein/antirepressor Ant -
  JLZ94_RS08035 (ETECE2980_01969) - 1606487..1608526 (+) 2040 WP_200999704.1 phage tailspike protein -
  JLZ94_RS08040 (ETECE2980_01970) - 1608583..1609908 (-) 1326 WP_001703470.1 O-antigen polymerase -
  JLZ94_RS08045 (ETECE2980_01971) intS 1610323..1611474 (-) 1152 WP_001388105.1 prophage integrase IntS -

Sequence


Protein


Download         Length: 168 a.a.        Molecular weight: 18761.06 Da        Isoelectric Point: 8.4877

>NTDB_id=1133006 JLZ94_RS07765 WP_000098523.1 1572968..1573474(-) (ssb) [Escherichia coli isolate L3_CS7_E2980]
MSSRGINKVIILGRVGQDPEVRYSPSGTAFANLTIATSEQWRDKNTGEQKELTEWHRVAVSGKLAEVVGQYVKKGDQIYF
EGMLRTRKWKDQSGQDRYTTEVHVGINGVMQMLGGIGDSKQQAASRQSQKPQQQSSPAQHNEPPMDFDDDIPFAPVTLPF
PRHAIHAI

Nucleotide


Download         Length: 507 bp        

>NTDB_id=1133006 JLZ94_RS07765 WP_000098523.1 1572968..1573474(-) (ssb) [Escherichia coli isolate L3_CS7_E2980]
ATGAGTTCTCGCGGGATAAATAAGGTGATTATCCTTGGTCGGGTAGGACAAGACCCGGAAGTTCGATACTCACCATCAGG
AACAGCGTTCGCTAACCTGACAATAGCCACGTCAGAACAATGGCGAGATAAAAATACTGGCGAGCAAAAGGAATTGACTG
AATGGCATCGTGTTGCTGTATCCGGGAAACTGGCTGAGGTCGTGGGGCAGTATGTGAAAAAAGGTGATCAGATTTATTTC
GAGGGAATGCTGAGAACCAGAAAGTGGAAAGACCAGTCAGGGCAAGACCGTTACACAACCGAGGTTCATGTCGGAATTAA
TGGCGTGATGCAAATGCTTGGCGGCATTGGCGACAGCAAACAACAAGCAGCCAGCAGGCAATCACAGAAGCCACAGCAGC
AATCATCACCAGCACAACACAACGAACCTCCGATGGATTTTGACGACGATATACCCTTTGCACCAGTAACTCTCCCCTTC
CCTCGTCACGCTATTCACGCAATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

61.017

100

0.643

  ssb Glaesserella parasuis strain SC1401

45.304

100

0.488

  ssb Neisseria meningitidis MC58

38.636

100

0.405

  ssb Neisseria gonorrhoeae MS11

38.636

100

0.405


Multiple sequence alignment