Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   BAMY6639_RS03010 Genome accession   NZ_CP006058
Coordinates   671301..671567 (-) Length   88 a.a.
NCBI ID   WP_060674857.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens UMAF6639     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 666301..676567
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAMY6639_RS02960 (BAMY6639_03125) sinR 666465..666800 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BAMY6639_RS02965 (BAMY6639_03130) tasA 666848..667633 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  BAMY6639_RS02970 (BAMY6639_03135) sipW 667698..668282 (-) 585 WP_061860711.1 signal peptidase I SipW -
  BAMY6639_RS02975 (BAMY6639_03140) tapA 668254..668925 (-) 672 WP_060674605.1 amyloid fiber anchoring/assembly protein TapA -
  BAMY6639_RS02980 (BAMY6639_03145) - 669184..669513 (+) 330 WP_060674607.1 DUF3889 domain-containing protein -
  BAMY6639_RS02985 (BAMY6639_03150) - 669553..669732 (-) 180 WP_003153093.1 YqzE family protein -
  BAMY6639_RS02990 (BAMY6639_03155) comGG 669789..670166 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  BAMY6639_RS02995 (BAMY6639_03160) comGF 670167..670562 (-) 396 WP_060674609.1 competence type IV pilus minor pilin ComGF -
  BAMY6639_RS03000 (BAMY6639_03165) comGE 670576..670890 (-) 315 WP_060674611.1 competence type IV pilus minor pilin ComGE -
  BAMY6639_RS03005 (BAMY6639_03170) comGD 670874..671311 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  BAMY6639_RS03010 (BAMY6639_03175) comGC 671301..671567 (-) 267 WP_060674857.1 competence type IV pilus major pilin ComGC Machinery gene
  BAMY6639_RS03015 (BAMY6639_03180) comGB 671614..672651 (-) 1038 WP_060674612.1 competence type IV pilus assembly protein ComGB Machinery gene
  BAMY6639_RS03020 (BAMY6639_03185) comGA 672638..673708 (-) 1071 WP_060674614.1 competence type IV pilus ATPase ComGA Machinery gene
  BAMY6639_RS03025 (BAMY6639_03190) - 673901..674851 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -
  BAMY6639_RS03030 (BAMY6639_03195) - 674997..676298 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9748.34 Da        Isoelectric Point: 6.2027

>NTDB_id=112947 BAMY6639_RS03010 WP_060674857.1 671301..671567(-) (comGC) [Bacillus amyloliquefaciens UMAF6639]
MLIVLFIVSILLLITIPNVTKHNQNIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=112947 BAMY6639_RS03010 WP_060674857.1 671301..671567(-) (comGC) [Bacillus amyloliquefaciens UMAF6639]
ATGCTGATTGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAACATTCA
GCATAAAGGGTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602


Multiple sequence alignment