Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | E0F39_RS11705 | Genome accession | NZ_LR216060 |
| Coordinates | 2166177..2166302 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799686.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain GPSC47 substr. ST315 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2161177..2171302
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0F39_RS13245 | - | 2161514..2163118 (-) | 1605 | Protein_2198 | YhgE/Pip family protein | - |
| E0F39_RS11680 (SAMEA3713867_02206) | - | 2163297..2163839 (+) | 543 | WP_001158263.1 | TetR/AcrR family transcriptional regulator | - |
| E0F39_RS11695 (SAMEA3713867_02209) | comE | 2164082..2164834 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| E0F39_RS11700 (SAMEA3713867_02210) | comD/comD2 | 2164831..2166156 (-) | 1326 | WP_001842237.1 | competence system sensor histidine kinase ComD | Regulator |
| E0F39_RS11705 (SAMEA3713867_02211) | comC/comC2 | 2166177..2166302 (-) | 126 | WP_000799686.1 | competence-stimulating peptide ComC | Regulator |
| E0F39_RS11715 (SAMEA3713867_02213) | rlmH | 2166584..2167063 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| E0F39_RS11720 (SAMEA3713867_02214) | htrA | 2167246..2168427 (+) | 1182 | WP_000681598.1 | S1C family serine protease | Regulator |
| E0F39_RS11725 (SAMEA3713867_02215) | spo0J | 2168485..2169243 (+) | 759 | WP_000410378.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| E0F39_RS11730 (SAMEA3713867_02216) | dnaA | 2169456..2170817 (+) | 1362 | WP_000660615.1 | chromosomal replication initiator protein DnaA | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4907.00 Da Isoelectric Point: 11.0006
>NTDB_id=1126234 E0F39_RS11705 WP_000799686.1 2166177..2166302(-) (comC/comC2) [Streptococcus pneumoniae strain GPSC47 substr. ST315]
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=1126234 E0F39_RS11705 WP_000799686.1 2166177..2166302(-) (comC/comC2) [Streptococcus pneumoniae strain GPSC47 substr. ST315]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae R6 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae G54 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae D39 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
57.5 |
97.561 |
0.561 |