Detailed information
Bioinformatically predicted
Overview
| Name | comW | Type | Regulator |
| Locus tag | E0F32_RS00015 | Genome accession | NZ_LR216050 |
| Coordinates | 1238..1474 (+) | Length | 78 a.a. |
| NCBI ID | WP_000939544.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain GPSC10 substr. ST2013 isolate GPS_US_PATH396-sc-2296505 | ||
| Function | stabilization and activation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1663..19295 | 1238..1474 | flank | 189 |
| IS/Tn | 715..921 | 1238..1474 | flank | 317 |
Gene organization within MGE regions
Location: 715..19295
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0F32_RS00015 (SAMEA3431333_00002) | comW | 1238..1474 (+) | 237 | WP_000939544.1 | sigma(X)-activator ComW | Regulator |
| E0F32_RS00020 (SAMEA3431333_00003) | - | 1705..2991 (+) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| E0F32_RS00025 (SAMEA3431333_00004) | tadA | 3192..3659 (+) | 468 | WP_000291870.1 | tRNA adenosine(34) deaminase TadA | - |
| E0F32_RS11690 (SAMEA3431333_00005) | - | 3868..4584 (-) | 717 | WP_001820871.1 | tyrosine-type recombinase/integrase | - |
| E0F32_RS11695 (SAMEA3431333_00006) | - | 4656..5003 (-) | 348 | WP_001839379.1 | hypothetical protein | - |
| E0F32_RS00045 (SAMEA3431333_00007) | - | 5064..6134 (-) | 1071 | WP_000401841.1 | type I restriction endonuclease | - |
| E0F32_RS00050 (SAMEA3431333_00008) | - | 6151..6531 (-) | 381 | WP_000170931.1 | ImmA/IrrE family metallo-endopeptidase | - |
| E0F32_RS00055 (SAMEA3431333_00009) | - | 6544..6807 (-) | 264 | WP_000285962.1 | type II toxin-antitoxin system RelE family toxin | - |
| E0F32_RS00060 (SAMEA3431333_00010) | - | 6807..7040 (-) | 234 | WP_000156419.1 | hypothetical protein | - |
| E0F32_RS00065 (SAMEA3431333_00011) | - | 7040..7408 (-) | 369 | WP_000464160.1 | helix-turn-helix domain-containing protein | - |
| E0F32_RS00070 (SAMEA3431333_00014) | - | 7980..8171 (+) | 192 | WP_001112859.1 | DNA-binding protein | - |
| E0F32_RS00075 (SAMEA3431333_00015) | - | 8194..8397 (+) | 204 | WP_001247549.1 | hypothetical protein | - |
| E0F32_RS00080 (SAMEA3431333_00017) | - | 8552..8719 (-) | 168 | WP_000024181.1 | YjzC family protein | - |
| E0F32_RS00085 (SAMEA3431333_00018) | - | 8724..9104 (+) | 381 | Protein_15 | autolysin | - |
| E0F32_RS00090 (SAMEA3431333_00019) | - | 9324..9503 (-) | 180 | WP_001209433.1 | hypothetical protein | - |
| E0F32_RS11490 | - | 9645..9794 (-) | 150 | WP_001030863.1 | hypothetical protein | - |
| E0F32_RS00095 (SAMEA3431333_00020) | - | 10099..10542 (+) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| E0F32_RS00100 (SAMEA3431333_00021) | - | 10544..11059 (+) | 516 | WP_000691236.1 | histidine phosphatase family protein | - |
| E0F32_RS00105 (SAMEA3431333_00022) | radA | 11073..12434 (+) | 1362 | WP_075213698.1 | DNA repair protein RadA | Machinery gene |
| E0F32_RS00110 (SAMEA3431333_00023) | - | 12507..13004 (+) | 498 | WP_001809263.1 | beta-class carbonic anhydrase | - |
| E0F32_RS00115 (SAMEA3431333_00024) | - | 13029..13844 (+) | 816 | WP_000749768.1 | PrsW family intramembrane metalloprotease | - |
| E0F32_RS00120 (SAMEA3431333_00025) | - | 13989..14957 (+) | 969 | WP_054377095.1 | ribose-phosphate diphosphokinase | - |
| E0F32_RS00125 | - | 15091..15372 (-) | 282 | Protein_24 | ISL3 family transposase | - |
| E0F32_RS11700 | - | 15499..16406 (-) | 908 | Protein_25 | Rpn family recombination-promoting nuclease/putative transposase | - |
| E0F32_RS00145 (SAMEA3431333_00029) | polA | 16662..19295 (+) | 2634 | WP_061384483.1 | DNA polymerase I | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 9667.10 Da Isoelectric Point: 6.4701
>NTDB_id=1126088 E0F32_RS00015 WP_000939544.1 1238..1474(+) (comW) [Streptococcus pneumoniae strain GPSC10 substr. ST2013 isolate GPS_US_PATH396-sc-2296505]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCHRDFIVYHYRVAYRLYLEKLVMNRGFISC
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCHRDFIVYHYRVAYRLYLEKLVMNRGFISC
Nucleotide
Download Length: 237 bp
>NTDB_id=1126088 E0F32_RS00015 WP_000939544.1 1238..1474(+) (comW) [Streptococcus pneumoniae strain GPSC10 substr. ST2013 isolate GPS_US_PATH396-sc-2296505]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCATAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCATAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus pneumoniae Rx1 |
97.436 |
100 |
0.974 |
| comW | Streptococcus pneumoniae D39 |
97.436 |
100 |
0.974 |
| comW | Streptococcus pneumoniae R6 |
97.436 |
100 |
0.974 |
| comW | Streptococcus pneumoniae TIGR4 |
97.436 |
100 |
0.974 |
| comW | Streptococcus mitis SK321 |
78.205 |
100 |
0.782 |
| comW | Streptococcus mitis NCTC 12261 |
77.922 |
98.718 |
0.769 |