Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   EL256_RS00970 Genome accession   NZ_LR134517
Coordinates   203045..203158 (+) Length   37 a.a.
NCBI ID   WP_001217870.1    Uniprot ID   -
Organism   Helicobacter pylori strain NCTC13345     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 198045..208158
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EL256_RS00945 (NCTC13345_00190) - 198092..200314 (+) 2223 WP_126442379.1 AAA family ATPase -
  EL256_RS00950 (NCTC13345_00191) panD 200304..200657 (+) 354 WP_000142244.1 aspartate 1-decarboxylase -
  EL256_RS00955 (NCTC13345_00192) - 200660..200962 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  EL256_RS00960 (NCTC13345_00193) - 200962..201966 (+) 1005 WP_126443606.1 PDZ domain-containing protein -
  EL256_RS00965 (NCTC13345_00194) comB6 201974..203029 (+) 1056 WP_126443607.1 P-type conjugative transfer protein TrbL Machinery gene
  EL256_RS00970 (NCTC13345_00195) comB7 203045..203158 (+) 114 WP_001217870.1 hypothetical protein Machinery gene
  EL256_RS00975 (NCTC13345_00196) comB8 203155..203898 (+) 744 WP_126442380.1 type IV secretion system protein Machinery gene
  EL256_RS00980 (NCTC13345_00197) comB9 203898..204872 (+) 975 WP_126442381.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  EL256_RS00985 (NCTC13345_00198) comB10 204865..206001 (+) 1137 WP_126442382.1 DNA type IV secretion system protein ComB10 Machinery gene
  EL256_RS00990 (NCTC13345_00199) - 206071..207483 (+) 1413 WP_126442383.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4305.26 Da        Isoelectric Point: 9.3572

>NTDB_id=1123750 EL256_RS00970 WP_001217870.1 203045..203158(+) (comB7) [Helicobacter pylori strain NCTC13345]
MRIFFVIMGLLLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=1123750 EL256_RS00970 WP_001217870.1 203045..203158(+) (comB7) [Helicobacter pylori strain NCTC13345]
ATGAGAATTTTTTTTGTTATCATGGGACTTTTGTTATTTGGTTGCACGAGCAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

94.595

100

0.946

Multiple sequence alignment