Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   EL244_RS06750 Genome accession   NZ_LR134396
Coordinates   1497493..1497999 (-) Length   168 a.a.
NCBI ID   WP_126459657.1    Uniprot ID   -
Organism   Providencia rustigianii strain NCTC8113     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1493543..1543942 1497493..1497999 within 0


Gene organization within MGE regions


Location: 1493543..1543942
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EL244_RS06710 (NCTC8113_01353) - 1493543..1494826 (-) 1284 WP_126459632.1 site-specific integrase -
  EL244_RS06715 (NCTC8113_01354) xisR 1494834..1495070 (-) 237 WP_126459636.1 excisionase family protein -
  EL244_RS18285 (NCTC8113_01355) - 1495063..1495308 (-) 246 WP_154631208.1 hypothetical protein -
  EL244_RS06725 (NCTC8113_01356) - 1495280..1495474 (-) 195 WP_126459642.1 hypothetical protein -
  EL244_RS06730 (NCTC8113_01357) - 1495482..1496027 (-) 546 WP_126459645.1 phage N-6-adenine-methyltransferase -
  EL244_RS06735 (NCTC8113_01358) - 1496017..1496235 (-) 219 WP_126459648.1 hypothetical protein -
  EL244_RS18380 - 1496232..1496429 (-) 198 WP_419179612.1 DUF7301 family protein -
  EL244_RS06740 (NCTC8113_01360) - 1496603..1497139 (-) 537 WP_126459651.1 hypothetical protein -
  EL244_RS06745 (NCTC8113_01361) - 1497255..1497452 (-) 198 WP_126459654.1 hypothetical protein -
  EL244_RS06750 (NCTC8113_01362) ssb 1497493..1497999 (-) 507 WP_126459657.1 single-stranded DNA-binding protein Machinery gene
  EL244_RS06755 (NCTC8113_01363) - 1497999..1498574 (-) 576 WP_126459660.1 ERF family protein -
  EL244_RS18290 (NCTC8113_01364) - 1498590..1499012 (-) 423 WP_126459662.1 hypothetical protein -
  EL244_RS18295 (NCTC8113_01366) - 1499043..1499243 (-) 201 WP_126459665.1 hypothetical protein -
  EL244_RS06770 (NCTC8113_01368) - 1499465..1500373 (-) 909 WP_126459668.1 cell envelope biogenesis protein TolA -
  EL244_RS17900 (NCTC8113_01369) - 1500388..1500561 (-) 174 WP_172597505.1 hypothetical protein -
  EL244_RS06775 (NCTC8113_01370) - 1500591..1500863 (-) 273 WP_126459671.1 hypothetical protein -
  EL244_RS06780 (NCTC8113_01371) - 1500976..1502709 (-) 1734 WP_126459674.1 DUF262 domain-containing protein -
  EL244_RS06785 (NCTC8113_01372) - 1502991..1503305 (-) 315 WP_230084848.1 hypothetical protein -
  EL244_RS06790 (NCTC8113_01373) - 1503665..1504351 (-) 687 WP_230084849.1 S24 family peptidase -
  EL244_RS06795 (NCTC8113_01374) - 1504468..1504653 (+) 186 WP_126459677.1 Cro/CI family transcriptional regulator -
  EL244_RS06800 (NCTC8113_01375) - 1504760..1505104 (+) 345 WP_126459680.1 hypothetical protein -
  EL244_RS06805 (NCTC8113_01376) - 1505174..1505863 (+) 690 WP_172597506.1 GIY-YIG nuclease family protein -
  EL244_RS18300 (NCTC8113_01377) - 1505863..1506648 (+) 786 WP_105881152.1 hypothetical protein -
  EL244_RS06815 (NCTC8113_01378) - 1506648..1507376 (+) 729 WP_109911125.1 ATP-binding protein -
  EL244_RS06820 (NCTC8113_01379) - 1507392..1507616 (+) 225 WP_126459683.1 hypothetical protein -
  EL244_RS06825 (NCTC8113_01380) - 1507648..1507920 (+) 273 WP_126459686.1 hypothetical protein -
  EL244_RS06830 (NCTC8113_01381) - 1507920..1508243 (+) 324 WP_126459689.1 hypothetical protein -
  EL244_RS18385 (NCTC8113_01382) - 1508230..1508478 (+) 249 WP_126459692.1 DUF551 domain-containing protein -
  EL244_RS06840 (NCTC8113_01383) - 1508478..1508753 (+) 276 WP_126459695.1 hypothetical protein -
  EL244_RS06845 (NCTC8113_01384) - 1508756..1509127 (+) 372 WP_126459697.1 phage protein NinX family protein -
  EL244_RS06850 (NCTC8113_01385) - 1509130..1509351 (+) 222 WP_232004567.1 DUF7279 family protein -
  EL244_RS06855 (NCTC8113_01386) - 1509353..1509799 (+) 447 WP_126459700.1 DUF1367 family protein -
  EL244_RS06860 - 1509812..1510027 (+) 216 WP_126459703.1 hypothetical protein -
  EL244_RS06865 (NCTC8113_01387) - 1510258..1510548 (+) 291 WP_126459706.1 DUF1364 domain-containing protein -
  EL244_RS06870 - 1510545..1510910 (+) 366 WP_126459709.1 RusA family crossover junction endodeoxyribonuclease -
  EL244_RS06875 (NCTC8113_01389) - 1511097..1511600 (+) 504 WP_126459712.1 antiterminator Q family protein -
  EL244_RS06880 (NCTC8113_01390) - 1512370..1512687 (+) 318 WP_036965310.1 phage holin, lambda family -
  EL244_RS06885 (NCTC8113_01391) - 1512680..1513072 (+) 393 WP_126459715.1 M15 family metallopeptidase -
  EL244_RS17995 lysC 1513316..1513615 (+) 300 WP_230084850.1 hypothetical protein -
  EL244_RS17905 (NCTC8113_01393) - 1513612..1513779 (+) 168 WP_154600546.1 hypothetical protein -
  EL244_RS06895 (NCTC8113_01394) - 1514106..1514777 (+) 672 WP_126459721.1 GIY-YIG nuclease family protein -
  EL244_RS06900 (NCTC8113_01395) - 1514948..1515187 (+) 240 WP_126459724.1 hypothetical protein -
  EL244_RS06905 - 1515241..1515441 (+) 201 WP_126459727.1 hypothetical protein -
  EL244_RS06910 (NCTC8113_01396) - 1515445..1515690 (+) 246 WP_126459730.1 DUF2560 family protein -
  EL244_RS06915 (NCTC8113_01397) - 1515744..1516346 (+) 603 WP_126459733.1 hypothetical protein -
  EL244_RS06920 (NCTC8113_01398) - 1516349..1517833 (+) 1485 WP_126459738.1 terminase -
  EL244_RS06925 (NCTC8113_01399) - 1517835..1519211 (+) 1377 WP_126459741.1 DUF4055 domain-containing protein -
  EL244_RS06930 (NCTC8113_01400) - 1519220..1520284 (+) 1065 WP_126459744.1 minor capsid protein -
  EL244_RS06935 (NCTC8113_01401) - 1520359..1521045 (+) 687 WP_126462753.1 hypothetical protein -
  EL244_RS06940 (NCTC8113_01402) - 1521051..1522001 (+) 951 WP_126459746.1 major capsid protein -
  EL244_RS06945 (NCTC8113_01403) - 1522045..1522422 (+) 378 WP_126459749.1 DUF7370 family protein -
  EL244_RS06950 (NCTC8113_01404) - 1522424..1522795 (+) 372 WP_126459751.1 hypothetical protein -
  EL244_RS06955 (NCTC8113_01405) - 1522797..1523153 (+) 357 WP_126459754.1 HK97 gp10 family phage protein -
  EL244_RS06960 (NCTC8113_01406) - 1523150..1523518 (+) 369 WP_126459756.1 hypothetical protein -
  EL244_RS06965 (NCTC8113_01407) - 1523580..1524320 (+) 741 WP_126459759.1 Ig-like domain-containing protein -
  EL244_RS06970 (NCTC8113_01408) - 1524369..1525055 (+) 687 WP_126459761.1 DUF6246 family protein -
  EL244_RS06975 (NCTC8113_01409) - 1525058..1525318 (+) 261 WP_126459763.1 hypothetical protein -
  EL244_RS06980 (NCTC8113_01410) - 1525327..1525572 (-) 246 WP_126459766.1 Arc family DNA-binding protein -
  EL244_RS06985 (NCTC8113_01411) - 1525846..1526844 (+) 999 WP_230084851.1 hypothetical protein -
  EL244_RS06990 (NCTC8113_01412) - 1526912..1527760 (-) 849 WP_126459771.1 ORF6N domain-containing protein -
  EL244_RS18390 - 1527831..1527989 (-) 159 WP_081335999.1 Arc family DNA-binding protein -
  EL244_RS07000 (NCTC8113_01413) - 1528104..1528349 (+) 246 WP_126459773.1 Arc family DNA-binding protein -
  EL244_RS07005 (NCTC8113_01414) - 1528450..1529295 (+) 846 WP_126459776.1 ParA family protein -
  EL244_RS07010 (NCTC8113_01415) - 1529282..1529701 (+) 420 WP_230084852.1 hypothetical protein -
  EL244_RS18000 - 1529981..1530349 (+) 369 WP_232004568.1 hypothetical protein -
  EL244_RS07020 (NCTC8113_01416) - 1530456..1531604 (+) 1149 WP_126459780.1 hypothetical protein -
  EL244_RS07025 (NCTC8113_01417) - 1531676..1534918 (+) 3243 WP_126459783.1 hypothetical protein -
  EL244_RS07030 (NCTC8113_01418) - 1534928..1535551 (+) 624 WP_126459786.1 hypothetical protein -
  EL244_RS07035 (NCTC8113_01419) - 1535584..1536066 (+) 483 WP_126459788.1 hypothetical protein -
  EL244_RS07040 (NCTC8113_01420) - 1536063..1536530 (+) 468 WP_036943373.1 DUF1833 family protein -
  EL244_RS07045 (NCTC8113_01421) - 1536623..1536922 (+) 300 WP_336426557.1 peptidoglycan endopeptidase -
  EL244_RS07050 (NCTC8113_01422) - 1536909..1539383 (+) 2475 WP_126459793.1 host specificity factor TipJ family phage tail protein -
  EL244_RS07055 (NCTC8113_01423) - 1539446..1541464 (+) 2019 WP_126459796.1 M14 family zinc carboxypeptidase -
  EL244_RS07060 (NCTC8113_01424) - 1541615..1541773 (-) 159 Protein_1366 DNA polymerase III subunit theta -
  EL244_RS07065 (NCTC8113_01425) - 1542260..1542667 (+) 408 WP_126459800.1 hypothetical protein -
  EL244_RS07075 (NCTC8113_01427) - 1543116..1543475 (+) 360 WP_126459805.1 hypothetical protein -
  EL244_RS07080 (NCTC8113_01428) - 1543655..1543942 (+) 288 WP_126459808.1 putative quinol monooxygenase -

Sequence


Protein


Download         Length: 168 a.a.        Molecular weight: 18562.89 Da        Isoelectric Point: 7.3147

>NTDB_id=1122751 EL244_RS06750 WP_126459657.1 1497493..1497999(-) (ssb) [Providencia rustigianii strain NCTC8113]
MASRGVNKVILIGHLGNDPEIRYMPNGGAVANLTLATSESWRDKQSGEMREKTEWHKVIIFGKLAEVAGEYLKKGSQVYI
EGSLQTRKWQDQSGQDRYTTEVVVNIGGSMQMLGGNGNSNQAGSQQPARQPQPPRQQAPQNEPPMDFSDDIPFAPIGLPY
PRHAIYVI

Nucleotide


Download         Length: 507 bp        

>NTDB_id=1122751 EL244_RS06750 WP_126459657.1 1497493..1497999(-) (ssb) [Providencia rustigianii strain NCTC8113]
ATGGCTAGTCGCGGAGTAAATAAGGTAATTCTCATTGGTCACTTAGGTAATGATCCTGAAATTCGGTACATGCCTAACGG
TGGCGCAGTAGCAAATCTCACACTAGCTACATCGGAATCGTGGCGTGATAAACAATCGGGTGAAATGCGCGAAAAAACAG
AGTGGCATAAAGTGATAATTTTCGGCAAGTTAGCTGAAGTTGCAGGTGAATATCTGAAAAAAGGATCACAAGTCTATATC
GAAGGTTCTTTGCAAACGCGTAAATGGCAAGACCAAAGCGGTCAAGACCGATACACAACGGAAGTGGTGGTAAATATCGG
CGGCTCTATGCAGATGTTGGGTGGCAATGGTAACAGCAATCAGGCAGGAAGCCAGCAACCAGCGCGACAACCTCAGCCGC
CACGCCAGCAAGCACCGCAGAATGAGCCACCGATGGATTTCTCAGACGATATTCCGTTCGCTCCTATCGGGCTCCCCTAC
CCACGCCACGCTATTTATGTGATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

67.232

100

0.708

  ssb Glaesserella parasuis strain SC1401

53.591

100

0.577

  ssb Neisseria gonorrhoeae MS11

47.159

100

0.494

  ssb Neisseria meningitidis MC58

46.591

100

0.488


Multiple sequence alignment